BLASTX nr result
ID: Glycyrrhiza32_contig00032346
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032346 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013443758.1 DUF247 domain protein [Medicago truncatula] KEH17... 86 3e-17 ACU14173.1 unknown, partial [Glycine max] 81 1e-16 XP_006576736.1 PREDICTED: UPF0481 protein At3g47200-like isoform... 81 5e-16 XP_003530156.1 PREDICTED: UPF0481 protein At3g47200 [Glycine max... 81 1e-15 XP_013443757.1 DUF247 domain protein [Medicago truncatula] KEH17... 79 9e-15 XP_004510120.1 PREDICTED: UPF0481 protein At3g47200-like [Cicer ... 78 2e-14 KHN18968.1 UPF0481 protein [Glycine soja] 78 2e-14 XP_019463930.1 PREDICTED: UPF0481 protein At3g47200-like [Lupinu... 77 4e-14 KYP33778.1 UPF0481 protein At3g47200 family [Cajanus cajan] 77 6e-14 XP_014515059.1 PREDICTED: UPF0481 protein At3g47200-like [Vigna ... 77 6e-14 XP_017442128.1 PREDICTED: UPF0481 protein At3g47200-like [Vigna ... 77 6e-14 XP_015948215.1 PREDICTED: UPF0481 protein At3g47200-like [Arachi... 74 4e-13 XP_016182741.1 PREDICTED: UPF0481 protein At3g47200-like [Arachi... 74 4e-13 XP_007134503.1 hypothetical protein PHAVU_010G052900g [Phaseolus... 73 1e-12 GAU20173.1 hypothetical protein TSUD_352370 [Trifolium subterran... 72 2e-12 KHN18967.1 hypothetical protein glysoja_039891 [Glycine soja] 64 5e-10 KYP33783.1 UPF0481 protein At3g47200 family [Cajanus cajan] 62 8e-09 XP_018811696.1 PREDICTED: UPF0481 protein At3g47200-like [Juglan... 60 4e-08 XP_006583542.1 PREDICTED: UPF0481 protein At3g47200-like [Glycin... 60 4e-08 KHN18966.1 UPF0481 protein [Glycine soja] 60 5e-08 >XP_013443758.1 DUF247 domain protein [Medicago truncatula] KEH17783.1 DUF247 domain protein [Medicago truncatula] Length = 512 Score = 85.9 bits (211), Expect = 3e-17 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 ALSET YE V+NI IDI+VLEE S C+IYKVP+NLRKV +EAYTPQLISIGPIHL Sbjct: 10 ALSETEYEMVKNI-IDIEVLEELSLADCSIYKVPHNLRKVKQEAYTPQLISIGPIHL 65 >ACU14173.1 unknown, partial [Glycine max] Length = 211 Score = 81.3 bits (199), Expect = 1e-16 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET YE V++I IDI LEE +C+IYKVPYNLRKVNEEAYTPQ ISIGPIHL Sbjct: 11 SLSETEYEMVKHI-IDIPDLEELRLSECSIYKVPYNLRKVNEEAYTPQWISIGPIHL 66 >XP_006576736.1 PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Glycine max] XP_006576737.1 PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Glycine max] Length = 290 Score = 81.3 bits (199), Expect = 5e-16 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET YE V++I IDI LEE +C+IYKVPYNLRKVNEEAYTPQ ISIGPIHL Sbjct: 9 SLSETEYEMVKHI-IDIPDLEELRLSECSIYKVPYNLRKVNEEAYTPQWISIGPIHL 64 >XP_003530156.1 PREDICTED: UPF0481 protein At3g47200 [Glycine max] KRH48768.1 hypothetical protein GLYMA_07G111300 [Glycine max] Length = 505 Score = 81.3 bits (199), Expect = 1e-15 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET YE V++I IDI LEE +C+IYKVPYNLRKVNEEAYTPQ ISIGPIHL Sbjct: 11 SLSETEYEMVKHI-IDIPDLEELRLSECSIYKVPYNLRKVNEEAYTPQWISIGPIHL 66 >XP_013443757.1 DUF247 domain protein [Medicago truncatula] KEH17782.1 DUF247 domain protein [Medicago truncatula] Length = 499 Score = 79.0 bits (193), Expect = 9e-15 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = +1 Query: 190 LSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 LSET YE V+ I IDI VLE+ S +C+IYKVP+NLRKV +EAYTP+LISIGPIHL Sbjct: 11 LSETEYEMVKQI-IDIGVLEKLSLAECSIYKVPHNLRKVKQEAYTPELISIGPIHL 65 >XP_004510120.1 PREDICTED: UPF0481 protein At3g47200-like [Cicer arietinum] Length = 508 Score = 78.2 bits (191), Expect = 2e-14 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = +1 Query: 178 TIMALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 ++ ALSE+ YE V+NI IDI+VLEE + C+IYKVP+NLR+V +AYTP LISIGPIHL Sbjct: 7 SVAALSESEYELVKNI-IDIEVLEELNLSDCSIYKVPHNLREVEPKAYTPHLISIGPIHL 65 >KHN18968.1 UPF0481 protein [Glycine soja] Length = 503 Score = 77.8 bits (190), Expect = 2e-14 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET YE V++I IDI LEE +C+IYKV YNLRKVNEEAYTPQ ISIGPIHL Sbjct: 9 SLSETEYEMVKHI-IDIPDLEELRLSECSIYKVHYNLRKVNEEAYTPQWISIGPIHL 64 >XP_019463930.1 PREDICTED: UPF0481 protein At3g47200-like [Lupinus angustifolius] OIW01007.1 hypothetical protein TanjilG_16256 [Lupinus angustifolius] Length = 494 Score = 77.0 bits (188), Expect = 4e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 ALSET Y+ V++I ++I+VLEE + +IYKVP NLRKVNEEAYTPQLISIGPIH Sbjct: 8 ALSETEYDMVKHI-VEIRVLEELKLSESSIYKVPCNLRKVNEEAYTPQLISIGPIH 62 >KYP33778.1 UPF0481 protein At3g47200 family [Cajanus cajan] Length = 500 Score = 76.6 bits (187), Expect = 6e-14 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET +E V++I IDI LEE +C IYKVP+NLRKVNE+AYTPQ ISIGPIHL Sbjct: 11 SLSETEFEMVKHI-IDIPELEELCLSECCIYKVPFNLRKVNEDAYTPQWISIGPIHL 66 >XP_014515059.1 PREDICTED: UPF0481 protein At3g47200-like [Vigna radiata var. radiata] Length = 501 Score = 76.6 bits (187), Expect = 6e-14 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET +E V++I ID+ LEE +C+IYKVPYNLRKVNE+AYTP+ ISIGPIHL Sbjct: 11 SLSETEFEMVKHI-IDMPELEELRLSECSIYKVPYNLRKVNEDAYTPEWISIGPIHL 66 >XP_017442128.1 PREDICTED: UPF0481 protein At3g47200-like [Vigna angularis] XP_017442129.1 PREDICTED: UPF0481 protein At3g47200-like [Vigna angularis] KOM58657.1 hypothetical protein LR48_Vigan11g169100 [Vigna angularis] BAT96798.1 hypothetical protein VIGAN_09010100 [Vigna angularis var. angularis] Length = 501 Score = 76.6 bits (187), Expect = 6e-14 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET +E V++I ID+ LEE +C+IYKVPYNLRKVNE+AYTP+ ISIGPIHL Sbjct: 11 SLSETEFEMVKHI-IDMPELEELRLSECSIYKVPYNLRKVNEDAYTPEWISIGPIHL 66 >XP_015948215.1 PREDICTED: UPF0481 protein At3g47200-like [Arachis duranensis] Length = 514 Score = 74.3 bits (181), Expect = 4e-13 Identities = 34/55 (61%), Positives = 46/55 (83%) Frame = +1 Query: 190 LSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 LSET YE V+++ ID++VL++ +C+IY VP NLRKVN+EAYTP++ISIGPIH Sbjct: 15 LSETEYEMVKHV-IDVRVLQDLKLSECSIYNVPCNLRKVNQEAYTPEMISIGPIH 68 >XP_016182741.1 PREDICTED: UPF0481 protein At3g47200-like [Arachis ipaensis] Length = 516 Score = 74.3 bits (181), Expect = 4e-13 Identities = 34/55 (61%), Positives = 46/55 (83%) Frame = +1 Query: 190 LSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 LSET YE V+++ ID++VL++ +C+IY VP NLRKVN+EAYTP++ISIGPIH Sbjct: 15 LSETEYEMVKHV-IDVRVLQDLKLSECSIYNVPCNLRKVNQEAYTPEMISIGPIH 68 >XP_007134503.1 hypothetical protein PHAVU_010G052900g [Phaseolus vulgaris] ESW06497.1 hypothetical protein PHAVU_010G052900g [Phaseolus vulgaris] Length = 499 Score = 72.8 bits (177), Expect = 1e-12 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = +1 Query: 187 ALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +LSET +E V++I ID+ LEE +C IYKVPYNLR VN +AYTPQ ISIGPIHL Sbjct: 11 SLSETEFEMVKHI-IDMPTLEELRLSECIIYKVPYNLRMVNMDAYTPQWISIGPIHL 66 >GAU20173.1 hypothetical protein TSUD_352370 [Trifolium subterraneum] Length = 508 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = +1 Query: 205 YETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +E V++I IDI+ LEE S +C+IYKVP NLRKV +EAYTPQLISIGPIHL Sbjct: 14 FEMVKHI-IDIEALEELSLAECSIYKVPPNLRKVKQEAYTPQLISIGPIHL 63 >KHN18967.1 hypothetical protein glysoja_039891 [Glycine soja] Length = 237 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +1 Query: 184 MALSETIYETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 + LSE + + V+++ I I+VLE S + TIYK P NLRKV E+AYTPQ ISIGPIHL Sbjct: 28 LPLSEEMTKMVKHV-IHIEVLEAPSLSKHTIYKAPKNLRKVKEDAYTPQCISIGPIHL 84 >KYP33783.1 UPF0481 protein At3g47200 family [Cajanus cajan] Length = 421 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 226 MIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIHL 357 +I I LE+ + C IYKVPYN+R+VN++AYTPQ ISIGPIHL Sbjct: 5 IIKIPGLEDLNLKDCCIYKVPYNIREVNKDAYTPQWISIGPIHL 48 >XP_018811696.1 PREDICTED: UPF0481 protein At3g47200-like [Juglans regia] XP_018811697.1 PREDICTED: UPF0481 protein At3g47200-like [Juglans regia] Length = 438 Score = 60.1 bits (144), Expect = 4e-08 Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = +1 Query: 199 TIYETVRNIMIDIKVLEESS----FPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 +I E+ +++IDIK L +SS P+C IYKVP + RK+NE+AYTP++ISIGP H Sbjct: 18 SIIESGDDLVIDIKELIDSSRPLFSPKCCIYKVPDHFRKLNEDAYTPRIISIGPFH 73 >XP_006583542.1 PREDICTED: UPF0481 protein At3g47200-like [Glycine max] XP_014633407.1 PREDICTED: UPF0481 protein At3g47200-like [Glycine max] KRH48770.1 hypothetical protein GLYMA_07G111500 [Glycine max] KRH48771.1 hypothetical protein GLYMA_07G111500 [Glycine max] Length = 451 Score = 60.1 bits (144), Expect = 4e-08 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 208 ETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 E V+++ IDI L+E Q +IYKVP+NLRKV EE YTPQ ISIGPIH Sbjct: 6 EMVKHV-IDIGELQELRLSQRSIYKVPHNLRKVKEEPYTPQCISIGPIH 53 >KHN18966.1 UPF0481 protein [Glycine soja] Length = 512 Score = 59.7 bits (143), Expect = 5e-08 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +1 Query: 187 ALSETIY-ETVRNIMIDIKVLEESSFPQCTIYKVPYNLRKVNEEAYTPQLISIGPIH 354 +L ET Y E V++ +ID V EE +IYKVP LRKV E+AYTPQ ISIGPIH Sbjct: 16 SLHETKYIERVKHALIDFGVPEELRLSDRSIYKVPCYLRKVKEDAYTPQCISIGPIH 72