BLASTX nr result
ID: Glycyrrhiza32_contig00032307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032307 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH37359.1 hypothetical protein GLYMA_09G061300 [Glycine max] 60 9e-09 KHN35827.1 DUF246 domain-containing protein [Glycine soja] 60 9e-09 XP_003533745.1 PREDICTED: uncharacterized protein LOC100775204 [... 60 9e-09 KHN24633.1 hypothetical protein glysoja_032277 [Glycine soja] 60 2e-08 KRH12354.1 hypothetical protein GLYMA_15G167600 [Glycine max] 60 2e-08 NP_001242787.1 uncharacterized protein LOC100818659 [Glycine max... 60 2e-08 KYP68916.1 DUF246 domain-containing protein At1g04910 family [Ca... 57 1e-07 GAU40188.1 hypothetical protein TSUD_374960 [Trifolium subterran... 54 2e-06 >KRH37359.1 hypothetical protein GLYMA_09G061300 [Glycine max] Length = 395 Score = 60.5 bits (145), Expect = 9e-09 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 +QKLQ+W+ SN F AVD++T++ G+ECH+KD +GRKLCY Sbjct: 218 IQKLQSWSQNSNGKFIAVDLRTEMVGRECHKKDVSGRKLCY 258 >KHN35827.1 DUF246 domain-containing protein [Glycine soja] Length = 420 Score = 60.5 bits (145), Expect = 9e-09 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 +QKLQ+W+ SN F AVD++T++ G+ECH+KD +GRKLCY Sbjct: 243 IQKLQSWSQNSNGKFIAVDLRTEMVGRECHKKDVSGRKLCY 283 >XP_003533745.1 PREDICTED: uncharacterized protein LOC100775204 [Glycine max] KRH37358.1 hypothetical protein GLYMA_09G061300 [Glycine max] Length = 420 Score = 60.5 bits (145), Expect = 9e-09 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 +QKLQ+W+ SN F AVD++T++ G+ECH+KD +GRKLCY Sbjct: 243 IQKLQSWSQNSNGKFIAVDLRTEMVGRECHKKDVSGRKLCY 283 >KHN24633.1 hypothetical protein glysoja_032277 [Glycine soja] Length = 370 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 VQKLQ+W+ SN F AVD++T++ KECH+KD +GRKLCY Sbjct: 193 VQKLQSWSQNSNGQFIAVDLRTEMVAKECHKKDVSGRKLCY 233 >KRH12354.1 hypothetical protein GLYMA_15G167600 [Glycine max] Length = 420 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 VQKLQ+W+ SN F AVD++T++ KECH+KD +GRKLCY Sbjct: 243 VQKLQSWSQNSNGQFIAVDLRTEMVAKECHKKDVSGRKLCY 283 >NP_001242787.1 uncharacterized protein LOC100818659 [Glycine max] ACU17958.1 unknown [Glycine max] Length = 420 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 VQKLQ+W+ SN F AVD++T++ KECH+KD +GRKLCY Sbjct: 243 VQKLQSWSQNSNGQFIAVDLRTEMVAKECHKKDVSGRKLCY 283 >KYP68916.1 DUF246 domain-containing protein At1g04910 family [Cajanus cajan] Length = 398 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 VQKLQ + SN F AVD++T++ GKECHRKD +GRKLCY Sbjct: 241 VQKLQCLSQNSNGQFIAVDLRTEMPGKECHRKDVSGRKLCY 281 >GAU40188.1 hypothetical protein TSUD_374960 [Trifolium subterraneum] Length = 387 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 141 VQKLQTWTYYSNDNFNAVDMKTDVWGKECHRKDETGRKLCY 263 VQ LQTW+ SN F AVD++T+V EC+ KDE GRK CY Sbjct: 211 VQNLQTWSQESNGQFVAVDLRTEVLKNECNGKDEKGRKQCY 251