BLASTX nr result
ID: Glycyrrhiza32_contig00032113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032113 (720 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013454322.1 hypothetical protein MTR_5g088215 [Medicago trunc... 49 2e-09 >XP_013454322.1 hypothetical protein MTR_5g088215 [Medicago truncatula] KEH28353.1 hypothetical protein MTR_5g088215 [Medicago truncatula] Length = 103 Score = 48.9 bits (115), Expect(2) = 2e-09 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +3 Query: 492 ALRAHQVWPLVALEVNRRIQAPSVDADVRTYELILA 599 ++ HQVWPL+ALEVN +QAPSVDAD Y+ ILA Sbjct: 46 SITTHQVWPLLALEVNSTMQAPSVDADDIIYKQILA 81 Score = 41.6 bits (96), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +2 Query: 602 CFVARTYVSGKPTPQANKIWCD 667 C+ A YVS KPT QANKIWCD Sbjct: 82 CYAASVYVSAKPTSQANKIWCD 103