BLASTX nr result
ID: Glycyrrhiza32_contig00031987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031987 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014627150.1 PREDICTED: AP2-like ethylene-responsive transcrip... 65 6e-10 XP_014491086.1 PREDICTED: ethylene-responsive transcription fact... 62 8e-09 XP_017411524.1 PREDICTED: ethylene-responsive transcription fact... 59 7e-08 KOM24861.1 hypothetical protein LR48_Vigan2287s000100 [Vigna ang... 59 8e-08 >XP_014627150.1 PREDICTED: AP2-like ethylene-responsive transcription factor BBM1 [Glycine max] Length = 408 Score = 65.1 bits (157), Expect = 6e-10 Identities = 37/56 (66%), Positives = 41/56 (73%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREEEEAFQISPFTHQIINSSD 319 VDRRHGKRP PSDHAS EER+ FNF + PSP KS + EEA Q S F H I N+SD Sbjct: 100 VDRRHGKRPFPSDHASREEREGFNFSV-LPSPPKS-QGEEASQFS-FIHPINNTSD 152 >XP_014491086.1 PREDICTED: ethylene-responsive transcription factor ERF113-like [Vigna radiata var. radiata] Length = 291 Score = 61.6 bits (148), Expect = 8e-09 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREEEEAFQISPFTHQIINSSD 319 VDRRHGKRPLPSDHAS E R+ FNF PS+ REE +F PF Q IN++D Sbjct: 16 VDRRHGKRPLPSDHASRENREGFNF------PSQQREEASSF---PFLQQPINTAD 62 >XP_017411524.1 PREDICTED: ethylene-responsive transcription factor ERF113-like, partial [Vigna angularis] Length = 290 Score = 58.9 bits (141), Expect = 7e-08 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREEEEAFQISPFTHQIINSSD 319 VDRRHGKRPLPSDHAS E R+ FNF PS+ EE +F PF Q IN++D Sbjct: 9 VDRRHGKRPLPSDHASRENREGFNF------PSQQGEEASSF---PFLQQPINTAD 55 >KOM24861.1 hypothetical protein LR48_Vigan2287s000100 [Vigna angularis] Length = 298 Score = 58.9 bits (141), Expect = 8e-08 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREEEEAFQISPFTHQIINSSD 319 VDRRHGKRPLPSDHAS E R+ FNF PS+ EE +F PF Q IN++D Sbjct: 17 VDRRHGKRPLPSDHASRENREGFNF------PSQQGEEASSF---PFLQQPINTAD 63