BLASTX nr result
ID: Glycyrrhiza32_contig00031852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031852 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019427353.1 PREDICTED: uncharacterized protein LOC109335650 i... 53 1e-05 >XP_019427353.1 PREDICTED: uncharacterized protein LOC109335650 isoform X1 [Lupinus angustifolius] OIV90397.1 hypothetical protein TanjilG_10697 [Lupinus angustifolius] Length = 168 Score = 52.8 bits (125), Expect = 1e-05 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = +3 Query: 252 TFTQTPSASKPQLCNNNIEMAMKELVLPPPSLDVITTAEGSSVVADEGEVESGRERLKRH 431 T TQTPS++ +NNIE A++ LVL P +V T + + + E +SGRERLK+H Sbjct: 47 TQTQTPSSASKTHLSNNIENALQGLVLHP---EVDITEKSVELETEAMEEDSGRERLKKH 103 Query: 432 RVEVA 446 RVEVA Sbjct: 104 RVEVA 108