BLASTX nr result
ID: Glycyrrhiza32_contig00031818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031818 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013448260.1 hypothetical protein MTR_7g038710 [Medicago trunc... 62 5e-10 XP_003613963.2 F-box protein interaction domain protein [Medicag... 63 2e-09 XP_003622191.1 hypothetical protein MTR_7g030040 [Medicago trunc... 62 3e-09 XP_013463588.1 F-box protein interaction domain protein [Medicag... 60 1e-08 XP_003622807.1 F-box protein interaction domain protein [Medicag... 58 7e-08 XP_013463587.1 F-box protein interaction domain protein [Medicag... 58 9e-08 XP_003605393.1 F-box protein interaction domain protein [Medicag... 57 2e-07 GAU45634.1 hypothetical protein TSUD_175470 [Trifolium subterran... 57 2e-07 XP_013447526.1 F-box protein interaction domain protein [Medicag... 56 4e-07 XP_013442030.1 hypothetical protein MTR_0354s0030 [Medicago trun... 53 5e-07 XP_013448352.1 F-box protein interaction domain protein [Medicag... 55 6e-07 XP_004491718.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 8e-07 XP_013463277.1 F-box protein interaction domain protein [Medicag... 55 8e-07 GAU42019.1 hypothetical protein TSUD_236860 [Trifolium subterran... 55 1e-06 XP_013451293.1 F-box protein interaction domain protein [Medicag... 54 2e-06 GAU49206.1 hypothetical protein TSUD_260560 [Trifolium subterran... 54 3e-06 XP_013451292.1 F-box protein interaction domain protein [Medicag... 53 5e-06 XP_003622881.2 F-box protein interaction domain protein [Medicag... 53 5e-06 XP_003622891.2 F-box protein interaction domain protein [Medicag... 53 5e-06 XP_003622885.1 F-box protein interaction domain protein [Medicag... 53 5e-06 >XP_013448260.1 hypothetical protein MTR_7g038710 [Medicago truncatula] KEH22287.1 hypothetical protein MTR_7g038710 [Medicago truncatula] Length = 155 Score = 62.0 bits (149), Expect = 5e-10 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = +3 Query: 15 PWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 P FPLC+ E G LIL I + +AI+YNWRDN+V+RI T ILW +Y Sbjct: 90 PQVFPLCLSEKGGTLILGIN--------SGNQAIIYNWRDNRVKRIKNTNRILWLHSKNY 141 Query: 195 IESLVS 212 +ESLVS Sbjct: 142 VESLVS 147 >XP_003613963.2 F-box protein interaction domain protein [Medicago truncatula] AES96921.2 F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/68 (45%), Positives = 42/68 (61%) Frame = +3 Query: 15 PWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 P FPLC+ ENG LILAI ++ +AI+YNWRDN+V++I T + W Y Sbjct: 395 PQVFPLCLSENGYTLILAINHSVFN---IRDQAILYNWRDNRVKKIENTCKKFWKASKGY 451 Query: 195 IESLVSIC 218 +ESL+S C Sbjct: 452 VESLISTC 459 >XP_003622191.1 hypothetical protein MTR_7g030040 [Medicago truncatula] AES78409.1 hypothetical protein MTR_7g030040 [Medicago truncatula] Length = 340 Score = 62.0 bits (149), Expect = 3e-09 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = +3 Query: 15 PWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 P FPLC+ E G LIL I + +AI+YNWRDN+V+RI T ILW +Y Sbjct: 279 PQVFPLCLSEKGGTLILGIN--------SGNQAIIYNWRDNRVKRIKNTNRILWLHSKNY 330 Query: 195 IESLVS 212 +ESLVS Sbjct: 331 VESLVS 336 >XP_013463588.1 F-box protein interaction domain protein [Medicago truncatula] KEH37623.1 F-box protein interaction domain protein [Medicago truncatula] Length = 418 Score = 60.5 bits (145), Expect = 1e-08 Identities = 30/69 (43%), Positives = 39/69 (56%) Frame = +3 Query: 6 YPSPWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGP 185 Y + PLCV E+ L++A + AI+YNWRDNKVE+I T ILW Sbjct: 348 YAQLFLLPLCVSESSNTLVMASNQRGLIHGYHRQHAILYNWRDNKVEQIATNNNILWFHT 407 Query: 186 WHYIESLVS 212 +Y+ESLVS Sbjct: 408 KNYVESLVS 416 >XP_003622807.1 F-box protein interaction domain protein [Medicago truncatula] AES79025.1 F-box protein interaction domain protein [Medicago truncatula] Length = 447 Score = 58.2 bits (139), Expect = 7e-08 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = +3 Query: 15 PWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 P PLC+ E+G+ +I +I + +AI+YNWRDN+V+RI +T I WS Y Sbjct: 367 PQLIPLCLSEDGDTIIFSINR--------ANQAILYNWRDNRVKRIKSTNMITWSLAKAY 418 Query: 195 IESLVS 212 +ESL+S Sbjct: 419 VESLIS 424 >XP_013463587.1 F-box protein interaction domain protein [Medicago truncatula] KEH37622.1 F-box protein interaction domain protein [Medicago truncatula] Length = 419 Score = 57.8 bits (138), Expect = 9e-08 Identities = 29/69 (42%), Positives = 39/69 (56%) Frame = +3 Query: 6 YPSPWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGP 185 Y + PLCV E+ L++A + AI+YNWRDNKVE+I T+ +I W Sbjct: 349 YAQLFLLPLCVSESSNTLVMASNQRGLIHGYHRRHAILYNWRDNKVEQIATSKQISWFNT 408 Query: 186 WHYIESLVS 212 Y+ESLVS Sbjct: 409 NDYVESLVS 417 >XP_003605393.1 F-box protein interaction domain protein [Medicago truncatula] AES87590.1 F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 57.0 bits (136), Expect = 2e-07 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = +3 Query: 12 SPW--FFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGE-ILWSG 182 S W F PLC+ +NG+ LILA + EA +YN RD++VE+IG T + +LW Sbjct: 332 SKWLDFLPLCLSKNGDTLILANNQ--------ENEAFIYNRRDDRVEKIGITNKNMLWFE 383 Query: 183 PWHYIESLVS 212 W Y+ESLVS Sbjct: 384 AWDYVESLVS 393 >GAU45634.1 hypothetical protein TSUD_175470 [Trifolium subterraneum] Length = 521 Score = 57.0 bits (136), Expect = 2e-07 Identities = 30/68 (44%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +3 Query: 18 WFFPLCVPENGEVLILAIKKIMYYK-MLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 + PLCV E+ LI+A + Y AIVYNWRDN VE+ + EI+W Y Sbjct: 350 FLLPLCVSESSNTLIMASNQEDYVAHFYGPQHAIVYNWRDNIVEQFTSNDEIMWFDTKDY 409 Query: 195 IESLVSIC 218 +ESLVS C Sbjct: 410 VESLVSTC 417 >XP_013447526.1 F-box protein interaction domain protein [Medicago truncatula] KEH21607.1 F-box protein interaction domain protein [Medicago truncatula] Length = 325 Score = 55.8 bits (133), Expect = 4e-07 Identities = 33/70 (47%), Positives = 39/70 (55%) Frame = +3 Query: 6 YPSPWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGP 185 Y P PL ENG+ LI AI T +A +YN RDN+VERI +T ILW Sbjct: 263 YYPPRLTPLYFSENGDTLIFAINP--------TDQAFLYNRRDNRVERIKSTNRILWFSA 314 Query: 186 WHYIESLVSI 215 Y+ESLVSI Sbjct: 315 KGYVESLVSI 324 >XP_013442030.1 hypothetical protein MTR_0354s0030 [Medicago truncatula] KEH16055.1 hypothetical protein MTR_0354s0030 [Medicago truncatula] Length = 97 Score = 52.8 bits (125), Expect = 5e-07 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = +3 Query: 6 YPSPWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGP 185 +P PLCV ENG+ LI A T AIVYN RDN+V RI +T +I W Sbjct: 35 FPEYIVCPLCVSENGDTLIFATNH--------TDLAIVYNLRDNRVNRIKSTNQIPWFNA 86 Query: 186 WHYIESLV 209 Y+ESLV Sbjct: 87 KGYVESLV 94 >XP_013448352.1 F-box protein interaction domain protein [Medicago truncatula] KEH22379.1 F-box protein interaction domain protein [Medicago truncatula] Length = 384 Score = 55.5 bits (132), Expect = 6e-07 Identities = 29/62 (46%), Positives = 38/62 (61%) Frame = +3 Query: 27 PLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHYIESL 206 PLCV ENG+ +I AI + + IVYNWR N+V+RI + +I WS Y+ESL Sbjct: 329 PLCVSENGDTVIFAINR--------RDQVIVYNWRYNRVKRIKSNKKIRWSNARGYVESL 380 Query: 207 VS 212 VS Sbjct: 381 VS 382 >XP_004491718.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 415 Score = 55.1 bits (131), Expect = 8e-07 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +3 Query: 3 KYPSPWF-FPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWS 179 +Y S F FPLC+ E+ + LI+A + +Y EAI+YNW DN+V R EILW Sbjct: 347 EYDSQLFLFPLCLSESSDTLIMASNQEIYLYA----EAIIYNWSDNRVARTRFNDEILWF 402 Query: 180 GPWHYIESLVS 212 Y ESLVS Sbjct: 403 FAKDYTESLVS 413 >XP_013463277.1 F-box protein interaction domain protein [Medicago truncatula] KEH37289.1 F-box protein interaction domain protein [Medicago truncatula] Length = 495 Score = 55.1 bits (131), Expect = 8e-07 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = +3 Query: 15 PWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHY 194 P PLC+ E+ + LI +I + +AI+YNW+DN+V+RI +T I WS Y Sbjct: 335 PQLIPLCLSEDVDTLIFSINQ--------AGQAILYNWKDNRVKRIKSTNRITWSRAKAY 386 Query: 195 IESLVS 212 +ESL+S Sbjct: 387 VESLIS 392 >GAU42019.1 hypothetical protein TSUD_236860 [Trifolium subterraneum] Length = 387 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +3 Query: 24 FPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHYIES 203 FPLC+ ENG+ L+LA + +AI+YN RD+ E+ G T W G Y+ES Sbjct: 331 FPLCLSENGDTLVLAWSR--------GKQAILYNLRDDTAEKTGYTNNFKWFGSQEYVES 382 Query: 204 LVSIC 218 L+S C Sbjct: 383 LISPC 387 >XP_013451293.1 F-box protein interaction domain protein [Medicago truncatula] KEH25333.1 F-box protein interaction domain protein [Medicago truncatula] Length = 389 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/69 (42%), Positives = 36/69 (52%) Frame = +3 Query: 6 YPSPWFFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGP 185 Y P PLC NG+ LI AI +A +YNWRDN +RI + G+ LW Sbjct: 327 YYPPRLIPLCFSNNGDTLIFAIN--------LPDQAFLYNWRDNTAKRIKSNGKNLWFSA 378 Query: 186 WHYIESLVS 212 Y+ESLVS Sbjct: 379 KGYVESLVS 387 >GAU49206.1 hypothetical protein TSUD_260560 [Trifolium subterraneum] Length = 387 Score = 53.5 bits (127), Expect = 3e-06 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = +3 Query: 27 PLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHYIESL 206 PL + ENG+ L+LA K YK EA +YN RDNKVE+IG I WS Y+ESL Sbjct: 332 PLYLSENGDTLVLANVK---YK-----EAFIYNPRDNKVEQIGIANHIKWSQSKGYVESL 383 Query: 207 VS 212 VS Sbjct: 384 VS 385 >XP_013451292.1 F-box protein interaction domain protein [Medicago truncatula] KEH25332.1 F-box protein interaction domain protein [Medicago truncatula] Length = 342 Score = 52.8 bits (125), Expect = 5e-06 Identities = 27/62 (43%), Positives = 37/62 (59%) Frame = +3 Query: 27 PLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWSGPWHYIESL 206 P+C ENG+ LI AI +AI+YNW+DN+ + I +T +ILW Y+ESL Sbjct: 287 PMCFSENGDTLIFAIN--------IPDQAILYNWKDNRAKIIESTNKILWFTAKGYVESL 338 Query: 207 VS 212 VS Sbjct: 339 VS 340 >XP_003622881.2 F-box protein interaction domain protein [Medicago truncatula] AES79099.2 F-box protein interaction domain protein [Medicago truncatula] Length = 360 Score = 52.8 bits (125), Expect = 5e-06 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 3 KYPSPW-FFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWS 179 +YP P FFPLC+ ENG+ LILA AI+YN RDN+ E I + W Sbjct: 294 QYPCPLSFFPLCLSENGDTLILAFD--------AANSAILYNLRDNRGEEIRIRNLVRWF 345 Query: 180 GPWHYIESLVS 212 +Y+ESLVS Sbjct: 346 CAKNYVESLVS 356 >XP_003622891.2 F-box protein interaction domain protein [Medicago truncatula] AES79109.2 F-box protein interaction domain protein [Medicago truncatula] Length = 426 Score = 52.8 bits (125), Expect = 5e-06 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 3 KYPSPW-FFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWS 179 +YP P FFPLC+ ENG+ LILA AI+YN RDN+ E I + W Sbjct: 362 QYPCPLSFFPLCLSENGDTLILAFD--------AANSAILYNLRDNRGEEIRIRNLVRWF 413 Query: 180 GPWHYIESLVS 212 +Y+ESLVS Sbjct: 414 CAKNYVESLVS 424 >XP_003622885.1 F-box protein interaction domain protein [Medicago truncatula] AES79103.1 F-box protein interaction domain protein [Medicago truncatula] Length = 426 Score = 52.8 bits (125), Expect = 5e-06 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 3 KYPSPW-FFPLCVPENGEVLILAIKKIMYYKMLTTYEAIVYNWRDNKVERIGTTGEILWS 179 +YP P FFPLC+ ENG+ LILA AI+YN RDN+ E I + W Sbjct: 362 QYPCPLSFFPLCLSENGDTLILAFD--------AANSAILYNLRDNRGEEIRIRNLVRWF 413 Query: 180 GPWHYIESLVS 212 +Y+ESLVS Sbjct: 414 CAKNYVESLVS 424