BLASTX nr result
ID: Glycyrrhiza32_contig00031726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031726 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH33885.1 hypothetical protein GLYMA_10G151400 [Glycine max] 59 3e-09 >KRH33885.1 hypothetical protein GLYMA_10G151400 [Glycine max] Length = 121 Score = 59.3 bits (142), Expect = 3e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 11 FVSKSKTL*ALIITFKIWPFAVTWELHVRILMAC 112 FVSK+KTL I+FK+WPFA TWELHVRILMAC Sbjct: 76 FVSKTKTLPTFYISFKMWPFAATWELHVRILMAC 109