BLASTX nr result
ID: Glycyrrhiza32_contig00031347
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031347 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69452.1 Anthranilate N-benzoyltransferase protein 2 [Cajanus ... 50 8e-06 ABD28420.1 Transferase, putative [Medicago truncatula] 51 8e-06 GAU45299.1 hypothetical protein TSUD_327570 [Trifolium subterran... 52 9e-06 >KYP69452.1 Anthranilate N-benzoyltransferase protein 2 [Cajanus cajan] Length = 131 Score = 50.4 bits (119), Expect = 8e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +2 Query: 5 GDGFIVTICLQASHIDALKKLFYEDIEEPTT 97 GDGF+V +CLQAS ID L KLFYEDIE P + Sbjct: 99 GDGFVVAVCLQASLIDHLNKLFYEDIENPAS 129 >ABD28420.1 Transferase, putative [Medicago truncatula] Length = 154 Score = 50.8 bits (120), Expect = 8e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +2 Query: 5 GDGFIVTICLQASHIDALKKLFYEDIEEPTT 97 GDGF++++CLQ HIDALKKLFYED+E T+ Sbjct: 121 GDGFVISVCLQPFHIDALKKLFYEDMEMITS 151 >GAU45299.1 hypothetical protein TSUD_327570 [Trifolium subterraneum] Length = 309 Score = 52.0 bits (123), Expect = 9e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +2 Query: 5 GDGFIVTICLQASHIDALKKLFYEDIE 85 GDGF+VT+CLQ HIDALKKLFYED+E Sbjct: 276 GDGFLVTVCLQPLHIDALKKLFYEDME 302