BLASTX nr result
ID: Glycyrrhiza32_contig00031301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031301 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015951992.1 PREDICTED: U-box domain-containing protein 44-lik... 68 2e-11 XP_016186979.1 PREDICTED: U-box domain-containing protein 44-lik... 67 4e-11 XP_014619962.1 PREDICTED: U-box domain-containing protein 44-lik... 64 7e-10 KHN25402.1 U-box domain-containing protein 44 [Glycine soja] 64 7e-10 XP_014619961.1 PREDICTED: U-box domain-containing protein 44-lik... 64 7e-10 XP_014619960.1 PREDICTED: U-box domain-containing protein 44-lik... 64 7e-10 XP_006592096.1 PREDICTED: U-box domain-containing protein 44-lik... 64 7e-10 KYP68271.1 U-box domain-containing protein 44 [Cajanus cajan] 64 1e-09 XP_006590886.1 PREDICTED: U-box domain-containing protein 44-lik... 62 5e-09 XP_006590883.1 PREDICTED: U-box domain-containing protein 44-lik... 62 5e-09 KYP59776.1 U-box domain-containing protein 43 [Cajanus cajan] 59 4e-08 XP_007148987.1 hypothetical protein PHAVU_005G031100g [Phaseolus... 59 4e-08 XP_003539233.1 PREDICTED: U-box domain-containing protein 44-lik... 57 1e-07 XP_014502043.1 PREDICTED: U-box domain-containing protein 44-lik... 57 2e-07 XP_017425725.1 PREDICTED: U-box domain-containing protein 44-lik... 57 2e-07 KHN18829.1 U-box domain-containing protein 43 [Glycine soja] 56 4e-07 XP_019443561.1 PREDICTED: U-box domain-containing protein 44-lik... 55 9e-07 OIW11807.1 hypothetical protein TanjilG_03468 [Lupinus angustifo... 55 9e-07 GAU20894.1 hypothetical protein TSUD_120860 [Trifolium subterran... 53 6e-06 XP_003598693.1 plant U-box protein, putative [Medicago truncatul... 52 8e-06 >XP_015951992.1 PREDICTED: U-box domain-containing protein 44-like [Arachis duranensis] Length = 829 Score = 68.2 bits (165), Expect = 2e-11 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +2 Query: 134 MNM-MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 MNM MEKR+F EFMSEL+ L +EV S NPE+E+DAFTEFA+LVEKL P Sbjct: 1 MNMIMEKRSFSEFMSELVALVDEVASFAMNPEVEIDAFTEFAMLVEKLAP 50 >XP_016186979.1 PREDICTED: U-box domain-containing protein 44-like [Arachis ipaensis] Length = 829 Score = 67.4 bits (163), Expect = 4e-11 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +2 Query: 134 MNM-MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 MNM MEKR+F EFMSE++ L +EV S NPE+E+DAFTEFA+LVEKL P Sbjct: 1 MNMIMEKRSFSEFMSEIVALVDEVASFAMNPEVEIDAFTEFAMLVEKLAP 50 >XP_014619962.1 PREDICTED: U-box domain-containing protein 44-like isoform X4 [Glycine max] KRH24418.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24419.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24420.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 829 Score = 63.9 bits (154), Expect = 7e-10 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFAMLVEKFAP 49 >KHN25402.1 U-box domain-containing protein 44 [Glycine soja] Length = 829 Score = 63.9 bits (154), Expect = 7e-10 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFAMLVEKFAP 49 >XP_014619961.1 PREDICTED: U-box domain-containing protein 44-like isoform X3 [Glycine max] KRH24421.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24422.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 830 Score = 63.9 bits (154), Expect = 7e-10 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFAMLVEKFAP 49 >XP_014619960.1 PREDICTED: U-box domain-containing protein 44-like isoform X2 [Glycine max] KRH24423.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24424.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24425.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 837 Score = 63.9 bits (154), Expect = 7e-10 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFAMLVEKFAP 49 >XP_006592096.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592097.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592098.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592099.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] Length = 838 Score = 63.9 bits (154), Expect = 7e-10 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFAMLVEKFAP 49 >KYP68271.1 U-box domain-containing protein 44 [Cajanus cajan] Length = 771 Score = 63.5 bits (153), Expect = 1e-09 Identities = 32/46 (69%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM-DAFTEFAILVEKL 274 M +KR+ YEF+SELIV+ +EV S KNPEIE+ DAFTEFA+LVEKL Sbjct: 1 MKDKRDLYEFVSELIVMADEVASLAKNPEIEIQDAFTEFALLVEKL 46 >XP_006590886.1 PREDICTED: U-box domain-containing protein 44-like isoform X2 [Glycine max] KHN39809.1 U-box domain-containing protein 43 [Glycine soja] KRH29402.1 hypothetical protein GLYMA_11G114500 [Glycine max] KRH29403.1 hypothetical protein GLYMA_11G114500 [Glycine max] Length = 828 Score = 61.6 bits (148), Expect = 5e-09 Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM-DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV +KNPEI++ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFLSELIVLADEVALFSKNPEIDIEDAFTEFAMLVEKFAP 48 >XP_006590883.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006590884.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006590885.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] KRH29404.1 hypothetical protein GLYMA_11G114500 [Glycine max] Length = 836 Score = 61.6 bits (148), Expect = 5e-09 Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +2 Query: 140 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM-DAFTEFAILVEKLLP 280 M EKR+F EF+SELIVL +EV +KNPEI++ DAFTEFA+LVEK P Sbjct: 1 MKEKRDFSEFLSELIVLADEVALFSKNPEIDIEDAFTEFAMLVEKFAP 48 >KYP59776.1 U-box domain-containing protein 43 [Cajanus cajan] Length = 830 Score = 58.9 bits (141), Expect = 4e-08 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M +ME+R F + +SELIVL +EV S KN EIE+D F EFA+LVEK P Sbjct: 1 MEIMEERKFSKLLSELIVLADEVASLAKNSEIEVDIFAEFAMLVEKFPP 49 >XP_007148987.1 hypothetical protein PHAVU_005G031100g [Phaseolus vulgaris] XP_007148988.1 hypothetical protein PHAVU_005G031100g [Phaseolus vulgaris] ESW20981.1 hypothetical protein PHAVU_005G031100g [Phaseolus vulgaris] ESW20982.1 hypothetical protein PHAVU_005G031100g [Phaseolus vulgaris] Length = 830 Score = 58.9 bits (141), Expect = 4e-08 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M ++EKRNF + +SELIVL +EV S KN EIE+ F EFA+LVEK P Sbjct: 1 MEVVEKRNFSKLLSELIVLADEVASLAKNSEIEVHIFAEFAMLVEKFSP 49 >XP_003539233.1 PREDICTED: U-box domain-containing protein 44-like [Glycine max] XP_006591162.1 PREDICTED: U-box domain-containing protein 44-like [Glycine max] XP_014619543.1 PREDICTED: U-box domain-containing protein 44-like [Glycine max] KRH29995.1 hypothetical protein GLYMA_11G152500 [Glycine max] KRH29996.1 hypothetical protein GLYMA_11G152500 [Glycine max] KRH29997.1 hypothetical protein GLYMA_11G152500 [Glycine max] Length = 831 Score = 57.4 bits (137), Expect = 1e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M +ME+R F + +SELIVL +EV S N EIE+D F EFA+LVEKL P Sbjct: 1 MEVMEERKFSKLLSELIVLADEVSSIAMNSEIEVDIFAEFAMLVEKLPP 49 >XP_014502043.1 PREDICTED: U-box domain-containing protein 44-like [Vigna radiata var. radiata] Length = 830 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M ++EKR F + +SELIVL +EV S KN EIE+ F+EFA+LVEK P Sbjct: 1 MEIVEKRKFSKLLSELIVLADEVASLAKNSEIEVHIFSEFAMLVEKFSP 49 >XP_017425725.1 PREDICTED: U-box domain-containing protein 44-like [Vigna angularis] XP_017425726.1 PREDICTED: U-box domain-containing protein 44-like [Vigna angularis] XP_017425727.1 PREDICTED: U-box domain-containing protein 44-like [Vigna angularis] KOM42553.1 hypothetical protein LR48_Vigan05g015700 [Vigna angularis] BAT93427.1 hypothetical protein VIGAN_07238800 [Vigna angularis var. angularis] Length = 830 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M ++EKR F + +SELIVL +EV S KN EIE+ F+EFA+LVEK P Sbjct: 1 MEIVEKRKFSKLLSELIVLADEVASLAKNSEIEVHIFSEFAMLVEKFSP 49 >KHN18829.1 U-box domain-containing protein 43 [Glycine soja] Length = 831 Score = 56.2 bits (134), Expect = 4e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M +ME+R F + +SELIVL +EV S N EIE+D F EFA+LVEKL P Sbjct: 1 MEVMEERKFSKLLSELIVLVDEVSSIAMNSEIEVDIFAEFAMLVEKLPP 49 >XP_019443561.1 PREDICTED: U-box domain-containing protein 44-like [Lupinus angustifolius] Length = 830 Score = 55.1 bits (131), Expect = 9e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M M+KR F E +SELIVL +EV KN ++E+D F EFA+LVEK P Sbjct: 1 MENMKKRKFSELLSELIVLADEVACFAKNSDMEVDIFAEFAMLVEKFSP 49 >OIW11807.1 hypothetical protein TanjilG_03468 [Lupinus angustifolius] Length = 899 Score = 55.1 bits (131), Expect = 9e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 134 MNMMEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 M M+KR F E +SELIVL +EV KN ++E+D F EFA+LVEK P Sbjct: 70 MENMKKRKFSELLSELIVLADEVACFAKNSDMEVDIFAEFAMLVEKFSP 118 >GAU20894.1 hypothetical protein TSUD_120860 [Trifolium subterraneum] Length = 827 Score = 52.8 bits (125), Expect = 6e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +2 Query: 143 MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 MEK F E +S++ VL +EVVS KN EIE +AF+EF +LVEKL P Sbjct: 1 MEKMEFSELLSKMKVLTDEVVSFAKNSEIEAEAFSEFGMLVEKLPP 46 >XP_003598693.1 plant U-box protein, putative [Medicago truncatula] AES68944.1 plant U-box protein, putative [Medicago truncatula] Length = 827 Score = 52.4 bits (124), Expect = 8e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +2 Query: 143 MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFAILVEKLLP 280 MEKR F E +S + L +EVVS K EIE+DAF+EF++LVEKL P Sbjct: 1 MEKREFSELVSTMNFLADEVVSFGKKTEIEVDAFSEFSMLVEKLPP 46