BLASTX nr result
ID: Glycyrrhiza32_contig00031266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031266 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442823.1 hypothetical protein MTR_0082s0070 [Medicago trun... 84 3e-19 >XP_013442823.1 hypothetical protein MTR_0082s0070 [Medicago truncatula] KEH16848.1 hypothetical protein MTR_0082s0070 [Medicago truncatula] Length = 110 Score = 84.3 bits (207), Expect = 3e-19 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 160 EFAAFPRPEKGLYCSPLFDMFIQYQYKRKLHQSGKAPIEAR 282 +FAAFPRPEKGLYCSPLFDMFIQYQYK KLHQSGKAP EAR Sbjct: 67 QFAAFPRPEKGLYCSPLFDMFIQYQYKLKLHQSGKAPTEAR 107