BLASTX nr result
ID: Glycyrrhiza32_contig00031186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00031186 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU43757.1 hypothetical protein TSUD_36510 [Trifolium subterraneum] 54 2e-06 XP_004495954.1 PREDICTED: caffeoylshikimate esterase-like isofor... 52 8e-06 XP_004495953.1 PREDICTED: caffeoylshikimate esterase-like isofor... 52 9e-06 >GAU43757.1 hypothetical protein TSUD_36510 [Trifolium subterraneum] Length = 252 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -3 Query: 302 VFADIIAWLDKRATSKAQVESYLPSQTLKHGNVDDLQERR 183 VF DII WLDKRATSKA++ES+LP T K N+ + QE R Sbjct: 208 VFRDIIRWLDKRATSKARIESFLPIPTYKRSNLHEFQEGR 247 >XP_004495954.1 PREDICTED: caffeoylshikimate esterase-like isoform X2 [Cicer arietinum] Length = 280 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 302 VFADIIAWLDKRATSKAQVESYLPSQTLKHG-NVDDLQERRASL 174 VF DII+WLDKRA+SKA++ES+L QT H N+ + Q RR+SL Sbjct: 237 VFGDIISWLDKRASSKARLESFLTIQTYNHSDNLHEFQGRRSSL 280 >XP_004495953.1 PREDICTED: caffeoylshikimate esterase-like isoform X1 [Cicer arietinum] Length = 322 Score = 52.4 bits (124), Expect = 9e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 302 VFADIIAWLDKRATSKAQVESYLPSQTLKHG-NVDDLQERRASL 174 VF DII+WLDKRA+SKA++ES+L QT H N+ + Q RR+SL Sbjct: 279 VFGDIISWLDKRASSKARLESFLTIQTYNHSDNLHEFQGRRSSL 322