BLASTX nr result
ID: Glycyrrhiza32_contig00030693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030693 (561 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV58277.1 hypothetical protein CFOL_v3_01811 [Cephalotus follic... 60 1e-08 >GAV58277.1 hypothetical protein CFOL_v3_01811 [Cephalotus follicularis] Length = 102 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 558 CYHLLCRHHRCREWGEEGMPLPHQHHLWVEWGCHQCLLLACLQWA-TDL 415 C L C HH+CREW E + H HH WV W C QC L AC QWA TDL Sbjct: 4 CCLLHCLHHQCREWVEVSL---HNHHQWVGWECLQCQLSACHQWAPTDL 49