BLASTX nr result
ID: Glycyrrhiza32_contig00030543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030543 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006440805.1 hypothetical protein CICLE_v10021357mg [Citrus cl... 69 2e-11 AHM92066.1 MADS-box protein 6 [Phyllostachys edulis] 69 3e-11 KDO70302.1 hypothetical protein CISIN_1g0260431mg, partial [Citr... 64 3e-11 KYP69795.1 Agamous-like MADS-box protein AGL3 [Cajanus cajan] 64 3e-11 XP_006440806.1 hypothetical protein CICLE_v10021357mg [Citrus cl... 69 3e-11 XP_006440804.1 hypothetical protein CICLE_v10021357mg [Citrus cl... 69 3e-11 AFX72878.1 MADS-box protein SEP2B [Aquilegia coerulea] 64 5e-11 XP_007153483.1 hypothetical protein PHAVU_003G039400g [Phaseolus... 64 5e-11 XP_016542717.1 PREDICTED: MADS-box protein CMB1-like [Capsicum a... 64 6e-11 KDO65669.1 hypothetical protein CISIN_1g0246401mg, partial [Citr... 63 8e-11 KDO72290.1 hypothetical protein CISIN_1g0261432mg, partial [Citr... 63 8e-11 AFN71022.1 RIN, partial [Solanum lycopersicum] 62 9e-11 EPS57613.1 hypothetical protein M569_17204 [Genlisea aurea] 63 9e-11 AAQ72506.1 MADS-box protein 12, partial [Petunia x hybrida] 62 1e-10 KYP40408.1 Agamous-like MADS-box protein AGL9 isogeny [Cajanus c... 63 1e-10 KYP71854.1 Developmental protein SEPALLATA 3 [Cajanus cajan] 63 1e-10 EYU33468.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [E... 63 2e-10 AAX82498.1 MADS box protein, partial [Oryza sativa Indica Group]... 62 2e-10 KYP56721.1 Agamous-like MADS-box protein AGL9 isogeny [Cajanus c... 63 2e-10 EYU33467.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [E... 63 2e-10 >XP_006440805.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] ESR54045.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] Length = 253 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 276 KQKIMGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 K+KIMGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 48 KRKIMGRGRVELKRIENKINRQVTFAKRRNGLLKK 82 >AHM92066.1 MADS-box protein 6 [Phyllostachys edulis] Length = 272 Score = 68.6 bits (166), Expect = 3e-11 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +3 Query: 219 GGIILKKKCLFDIKREIYIKQKIMGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 G + L C+ RE I+++IMGRG+VELKRIENKINRQVTF+KRRNGLLKK Sbjct: 4 GNVELISDCVL---REGKIEEEIMGRGRVELKRIENKINRQVTFSKRRNGLLKK 54 >KDO70302.1 hypothetical protein CISIN_1g0260431mg, partial [Citrus sinensis] Length = 61 Score = 63.9 bits (154), Expect = 3e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 31 >KYP69795.1 Agamous-like MADS-box protein AGL3 [Cajanus cajan] Length = 62 Score = 63.9 bits (154), Expect = 3e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 31 >XP_006440806.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] ESR54046.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] Length = 300 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 276 KQKIMGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 K+KIMGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 48 KRKIMGRGRVELKRIENKINRQVTFAKRRNGLLKK 82 >XP_006440804.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] ESR54044.1 hypothetical protein CICLE_v10021357mg [Citrus clementina] Length = 301 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 276 KQKIMGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 K+KIMGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 48 KRKIMGRGRVELKRIENKINRQVTFAKRRNGLLKK 82 >AFX72878.1 MADS-box protein SEP2B [Aquilegia coerulea] Length = 85 Score = 63.9 bits (154), Expect = 5e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 31 >XP_007153483.1 hypothetical protein PHAVU_003G039400g [Phaseolus vulgaris] ESW25477.1 hypothetical protein PHAVU_003G039400g [Phaseolus vulgaris] Length = 86 Score = 63.9 bits (154), Expect = 5e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 31 >XP_016542717.1 PREDICTED: MADS-box protein CMB1-like [Capsicum annuum] Length = 92 Score = 63.9 bits (154), Expect = 6e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 31 >KDO65669.1 hypothetical protein CISIN_1g0246401mg, partial [Citrus sinensis] Length = 61 Score = 62.8 bits (151), Expect = 8e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >KDO72290.1 hypothetical protein CISIN_1g0261432mg, partial [Citrus sinensis] Length = 61 Score = 62.8 bits (151), Expect = 8e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >AFN71022.1 RIN, partial [Solanum lycopersicum] Length = 30 Score = 62.0 bits (149), Expect = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLK 377 MGRGKVELKRIENKINRQVTFAKRRNGLLK Sbjct: 1 MGRGKVELKRIENKINRQVTFAKRRNGLLK 30 >EPS57613.1 hypothetical protein M569_17204 [Genlisea aurea] Length = 67 Score = 62.8 bits (151), Expect = 9e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >AAQ72506.1 MADS-box protein 12, partial [Petunia x hybrida] Length = 62 Score = 62.4 bits (150), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENK+NRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKVNRQVTFAKRRNGLLKK 31 >KYP40408.1 Agamous-like MADS-box protein AGL9 isogeny [Cajanus cajan] Length = 77 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >KYP71854.1 Developmental protein SEPALLATA 3 [Cajanus cajan] Length = 84 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >EYU33468.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe guttata] Length = 88 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >AAX82498.1 MADS box protein, partial [Oryza sativa Indica Group] KXG39867.1 hypothetical protein SORBI_001G4559002, partial [Sorghum bicolor] Length = 61 Score = 62.0 bits (149), Expect = 2e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRGKVELKRIENKI+RQVTFAKRRNGLLKK Sbjct: 1 MGRGKVELKRIENKISRQVTFAKRRNGLLKK 31 >KYP56721.1 Agamous-like MADS-box protein AGL9 isogeny [Cajanus cajan] Length = 89 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31 >EYU33467.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe guttata] EYU33469.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe guttata] EYU33470.1 hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe guttata] Length = 89 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 288 MGRGKVELKRIENKINRQVTFAKRRNGLLKK 380 MGRG+VELKRIENKINRQVTFAKRRNGLLKK Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKK 31