BLASTX nr result
ID: Glycyrrhiza32_contig00030465
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030465 (506 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36977.1 hypothetical protein TSUD_57550 [Trifolium subterraneum] 118 9e-28 XP_013455978.1 P-loop nucleoside triphosphate hydrolase superfam... 112 1e-25 XP_004506048.1 PREDICTED: P-loop NTPase domain-containing protei... 111 2e-25 GAU15697.1 hypothetical protein TSUD_109550 [Trifolium subterran... 105 8e-25 XP_013465342.1 2-phosphoglycerate kinase [Medicago truncatula] K... 106 1e-23 XP_004487082.1 PREDICTED: P-loop NTPase domain-containing protei... 105 2e-23 XP_004487078.1 PREDICTED: P-loop NTPase domain-containing protei... 105 2e-23 XP_016187478.1 PREDICTED: P-loop NTPase domain-containing protei... 104 7e-23 XP_015952442.1 PREDICTED: P-loop NTPase domain-containing protei... 103 1e-22 OIV99316.1 hypothetical protein TanjilG_17126 [Lupinus angustifo... 102 3e-22 XP_019413944.1 PREDICTED: P-loop NTPase domain-containing protei... 102 3e-22 XP_019413943.1 PREDICTED: P-loop NTPase domain-containing protei... 102 3e-22 OMO67371.1 hypothetical protein CCACVL1_20559, partial [Corchoru... 102 4e-22 OMO91557.1 hypothetical protein COLO4_18282 [Corchorus olitorius] 101 5e-22 XP_012064749.1 PREDICTED: P-loop NTPase domain-containing protei... 101 6e-22 XP_007132294.1 hypothetical protein PHAVU_011G082700g [Phaseolus... 100 2e-21 KYP68565.1 Uncharacterized protein DDB-G0273453/DDB-G0273565 [Ca... 100 3e-21 XP_007016824.2 PREDICTED: P-loop NTPase domain-containing protei... 98 1e-20 EOY34443.1 P-loop containing nucleoside triphosphate hydrolases ... 98 1e-20 XP_017409456.1 PREDICTED: P-loop NTPase domain-containing protei... 98 1e-20 >GAU36977.1 hypothetical protein TSUD_57550 [Trifolium subterraneum] Length = 653 Score = 118 bits (295), Expect = 9e-28 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 2/77 (2%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPV--ASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALG 331 Y QNLD FLRTRSEPVP+ AS EP CSYSS L+EKSERK+ +GK K RKRSLSIPALG Sbjct: 577 YHQNLDQFLRTRSEPVPLEMASQEPFCSYSSLLVEKSERKVISNGKSKFRKRSLSIPALG 636 Query: 330 KHSSAINDPILSGAPQR 280 KHSSAINDPILSG PQR Sbjct: 637 KHSSAINDPILSGTPQR 653 >XP_013455978.1 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] KEH30009.1 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] Length = 738 Score = 112 bits (279), Expect = 1e-25 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 2/77 (2%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVP--VASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALG 331 YRQNLD FLRTRSEPVP VAS EP C+Y S L EKSE+KLS +G+ KLRKRSLSIPALG Sbjct: 664 YRQNLDQFLRTRSEPVPIAVASQEPFCAYPSLLAEKSEKKLSSNGRAKLRKRSLSIPALG 723 Query: 330 KHSSAINDPILSGAPQR 280 KHSSA DPILSGAPQR Sbjct: 724 KHSSA--DPILSGAPQR 738 >XP_004506048.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like [Cicer arietinum] Length = 763 Score = 111 bits (278), Expect = 2e-25 Identities = 56/77 (72%), Positives = 65/77 (84%), Gaps = 2/77 (2%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVA--SPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALG 331 YR+NLD FLR+RSEPVP+A SPEP+CSYSS L+EK E+KL + K KLRKRSLSIPAL Sbjct: 687 YRRNLDQFLRSRSEPVPIAGASPEPLCSYSSMLVEKGEKKLPSNDKAKLRKRSLSIPALR 746 Query: 330 KHSSAINDPILSGAPQR 280 HS+A+NDPILSG PQR Sbjct: 747 NHSAAMNDPILSGTPQR 763 >GAU15697.1 hypothetical protein TSUD_109550 [Trifolium subterraneum] Length = 238 Score = 105 bits (261), Expect = 8e-25 Identities = 57/75 (76%), Positives = 59/75 (78%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YRQNLDLFLRTRSEPVP E CSYSS L EK ER+L PSGK KLRKRSLSI ALGK Sbjct: 168 YRQNLDLFLRTRSEPVP----ESFCSYSSLLKEKVERRLPPSGKAKLRKRSLSISALGKG 223 Query: 324 SSAINDPILSGAPQR 280 SSA+ DPI SG PQR Sbjct: 224 SSAVQDPIPSGTPQR 238 >XP_013465342.1 2-phosphoglycerate kinase [Medicago truncatula] KEH39377.1 2-phosphoglycerate kinase [Medicago truncatula] Length = 736 Score = 106 bits (265), Expect = 1e-23 Identities = 55/73 (75%), Positives = 61/73 (83%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YRQNLDLFLRTRSEPVP E +CSYSS L+EK+ER+L PSGK KLRKRSLSI ALGK Sbjct: 668 YRQNLDLFLRTRSEPVP----ESLCSYSSLLMEKAERRLPPSGKAKLRKRSLSISALGKG 723 Query: 324 SSAINDPILSGAP 286 SS + DPI+SGAP Sbjct: 724 SSTVQDPIISGAP 736 >XP_004487082.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X3 [Cicer arietinum] Length = 731 Score = 105 bits (263), Expect = 2e-23 Identities = 56/75 (74%), Positives = 60/75 (80%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YRQNLDLFLRTRSEPVP + CSYSS L+E ER+L PSGK K+RKRSLSI ALGK Sbjct: 661 YRQNLDLFLRTRSEPVP----DSFCSYSSLLMENVERRLPPSGKAKMRKRSLSISALGKG 716 Query: 324 SSAINDPILSGAPQR 280 SSAI DPILSG PQR Sbjct: 717 SSAIQDPILSGTPQR 731 >XP_004487078.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X1 [Cicer arietinum] XP_004487079.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X2 [Cicer arietinum] XP_004487080.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X1 [Cicer arietinum] XP_004487081.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X2 [Cicer arietinum] Length = 733 Score = 105 bits (263), Expect = 2e-23 Identities = 56/75 (74%), Positives = 60/75 (80%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YRQNLDLFLRTRSEPVP + CSYSS L+E ER+L PSGK K+RKRSLSI ALGK Sbjct: 663 YRQNLDLFLRTRSEPVP----DSFCSYSSLLMENVERRLPPSGKAKMRKRSLSISALGKG 718 Query: 324 SSAINDPILSGAPQR 280 SSAI DPILSG PQR Sbjct: 719 SSAIQDPILSGTPQR 733 >XP_016187478.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Arachis ipaensis] XP_016187480.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Arachis ipaensis] Length = 746 Score = 104 bits (259), Expect = 7e-23 Identities = 55/79 (69%), Positives = 65/79 (82%), Gaps = 4/79 (5%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEP---ICSYSSWLLEK-SERKLSPSGKDKLRKRSLSIPA 337 + +N+D+F RTRSEP+PV P P SYSS+L+EK SERK++P GK K+RKRSLSIPA Sbjct: 668 HNRNMDVFHRTRSEPIPVPGPGPGPDHRSYSSFLVEKKSERKITPRGKAKMRKRSLSIPA 727 Query: 336 LGKHSSAINDPILSGAPQR 280 GKHSSAINDPILSGAPQR Sbjct: 728 FGKHSSAINDPILSGAPQR 746 >XP_015952442.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Arachis duranensis] XP_015952443.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Arachis duranensis] Length = 748 Score = 103 bits (257), Expect = 1e-22 Identities = 55/81 (67%), Positives = 65/81 (80%), Gaps = 6/81 (7%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEP-----ICSYSSWLLEK-SERKLSPSGKDKLRKRSLSI 343 + +N+D+F RTRSEP+PV P P SYSS+L+EK SERK++P GK K+RKRSLSI Sbjct: 668 HNRNMDVFHRTRSEPIPVPGPGPGPGPDHRSYSSFLVEKKSERKITPRGKAKMRKRSLSI 727 Query: 342 PALGKHSSAINDPILSGAPQR 280 PA GKHSSAINDPILSGAPQR Sbjct: 728 PAFGKHSSAINDPILSGAPQR 748 >OIV99316.1 hypothetical protein TanjilG_17126 [Lupinus angustifolius] Length = 632 Score = 102 bits (254), Expect = 3e-22 Identities = 53/75 (70%), Positives = 59/75 (78%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y QNLD FLR+RSEP+ E YS ++EKSERKL P+ K KLRKRSLSIPALG+H Sbjct: 558 YSQNLDRFLRSRSEPMAALVQETQFCYSPMIVEKSERKLPPADKYKLRKRSLSIPALGRH 617 Query: 324 SSAINDPILSGAPQR 280 SSAINDPILSGAPQR Sbjct: 618 SSAINDPILSGAPQR 632 >XP_019413944.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X2 [Lupinus angustifolius] Length = 734 Score = 102 bits (254), Expect = 3e-22 Identities = 53/75 (70%), Positives = 59/75 (78%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y QNLD FLR+RSEP+ E YS ++EKSERKL P+ K KLRKRSLSIPALG+H Sbjct: 660 YSQNLDRFLRSRSEPMAALVQETQFCYSPMIVEKSERKLPPADKYKLRKRSLSIPALGRH 719 Query: 324 SSAINDPILSGAPQR 280 SSAINDPILSGAPQR Sbjct: 720 SSAINDPILSGAPQR 734 >XP_019413943.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X1 [Lupinus angustifolius] Length = 749 Score = 102 bits (254), Expect = 3e-22 Identities = 53/75 (70%), Positives = 59/75 (78%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y QNLD FLR+RSEP+ E YS ++EKSERKL P+ K KLRKRSLSIPALG+H Sbjct: 675 YSQNLDRFLRSRSEPMAALVQETQFCYSPMIVEKSERKLPPADKYKLRKRSLSIPALGRH 734 Query: 324 SSAINDPILSGAPQR 280 SSAINDPILSGAPQR Sbjct: 735 SSAINDPILSGAPQR 749 >OMO67371.1 hypothetical protein CCACVL1_20559, partial [Corchorus capsularis] Length = 689 Score = 102 bits (253), Expect = 4e-22 Identities = 50/75 (66%), Positives = 62/75 (82%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y +NLDLFLR+RSE +P EP+CSYSS L+EK+E+++ P G K+R+RSLSIPALGKH Sbjct: 619 YDKNLDLFLRSRSEQLP----EPLCSYSSLLMEKNEKRMPPIGNAKMRRRSLSIPALGKH 674 Query: 324 SSAINDPILSGAPQR 280 S I+DPILSGAPQR Sbjct: 675 GSIISDPILSGAPQR 689 >OMO91557.1 hypothetical protein COLO4_18282 [Corchorus olitorius] Length = 561 Score = 101 bits (252), Expect = 5e-22 Identities = 50/75 (66%), Positives = 62/75 (82%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y +NLDLFLR+RSE +P EP+CSYSS L+EK+E+++ P G K+R+RSLSIPALGKH Sbjct: 491 YDKNLDLFLRSRSEQLP----EPLCSYSSLLMEKNEKRVPPIGNAKMRRRSLSIPALGKH 546 Query: 324 SSAINDPILSGAPQR 280 S I+DPILSGAPQR Sbjct: 547 GSIISDPILSGAPQR 561 >XP_012064749.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Jatropha curcas] XP_012064750.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Jatropha curcas] KDP44001.1 hypothetical protein JCGZ_05468 [Jatropha curcas] Length = 710 Score = 101 bits (252), Expect = 6e-22 Identities = 51/75 (68%), Positives = 61/75 (81%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YRQNLD FLR+RSEP+ EP+C+YSS+L+EK ER+LS G K+RKRSLSIPA+GKH Sbjct: 640 YRQNLDRFLRSRSEPLG----EPLCAYSSFLVEKGERRLSNLGNVKMRKRSLSIPAIGKH 695 Query: 324 SSAINDPILSGAPQR 280 S + DPILSGAPQR Sbjct: 696 GSIVADPILSGAPQR 710 >XP_007132294.1 hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris] XP_007132295.1 hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris] ESW04288.1 hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris] ESW04289.1 hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris] Length = 729 Score = 100 bits (248), Expect = 2e-21 Identities = 56/75 (74%), Positives = 60/75 (80%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YR+NLDLF R+RSEPV V PEP CSYSS L+EKSERK KLR RSLSIPALGKH Sbjct: 663 YRRNLDLFHRSRSEPVGV--PEPQCSYSSLLVEKSERKA------KLRTRSLSIPALGKH 714 Query: 324 SSAINDPILSGAPQR 280 SA+NDPILSGAPQR Sbjct: 715 RSAMNDPILSGAPQR 729 >KYP68565.1 Uncharacterized protein DDB-G0273453/DDB-G0273565 [Cajanus cajan] Length = 736 Score = 99.8 bits (247), Expect = 3e-21 Identities = 54/77 (70%), Positives = 62/77 (80%), Gaps = 2/77 (2%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASP--EPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALG 331 YR+NLDLFLR+RSEPV +A+ EP+CSYSS L E+ ERK KLR RSLSIPALG Sbjct: 666 YRRNLDLFLRSRSEPVAMAAAVQEPLCSYSSLLHERRERKA------KLRTRSLSIPALG 719 Query: 330 KHSSAINDPILSGAPQR 280 KH+SA+NDPILSGAPQR Sbjct: 720 KHNSAVNDPILSGAPQR 736 >XP_007016824.2 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 2 [Theobroma cacao] Length = 723 Score = 98.2 bits (243), Expect = 1e-20 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y +NLDLFLR+RSE + EP+CSYSS L+E+++R L+P G K+RKRSLSIPA+GKH Sbjct: 653 YNKNLDLFLRSRSEQLS----EPLCSYSSLLMERNKRGLAPFGNVKMRKRSLSIPAIGKH 708 Query: 324 SSAINDPILSGAPQR 280 S I+DPILSGAPQR Sbjct: 709 GSIISDPILSGAPQR 723 >EOY34443.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 723 Score = 98.2 bits (243), Expect = 1e-20 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 Y +NLDLFLR+RSE + EP+CSYSS L+E+++R L+P G K+RKRSLSIPA+GKH Sbjct: 653 YNKNLDLFLRSRSEQLS----EPLCSYSSLLMERNKRGLAPFGNVKMRKRSLSIPAIGKH 708 Query: 324 SSAINDPILSGAPQR 280 S I+DPILSGAPQR Sbjct: 709 GSIISDPILSGAPQR 723 >XP_017409456.1 PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like [Vigna angularis] KOM28855.1 hypothetical protein LR48_Vigan598s001600 [Vigna angularis] Length = 732 Score = 98.2 bits (243), Expect = 1e-20 Identities = 54/75 (72%), Positives = 59/75 (78%) Frame = -3 Query: 504 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPALGKH 325 YR+NLDLF R+RSEPV V PEP CSYSS L+EK+ERK KLR RSLSIPALGKH Sbjct: 666 YRRNLDLFYRSRSEPVAV--PEPQCSYSSLLVEKNERKA------KLRTRSLSIPALGKH 717 Query: 324 SSAINDPILSGAPQR 280 A+NDPILSGAPQR Sbjct: 718 RPAMNDPILSGAPQR 732