BLASTX nr result
ID: Glycyrrhiza32_contig00030434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030434 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago ... 112 2e-29 XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 3e-28 GAU35738.1 hypothetical protein TSUD_370030 [Trifolium subterran... 115 7e-28 GAU22521.1 hypothetical protein TSUD_296410 [Trifolium subterran... 115 1e-27 XP_004514199.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-27 XP_012575234.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 4e-27 XP_003619805.1 pentatricopeptide (PPR) repeat protein [Medicago ... 113 1e-26 XP_004504486.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 2e-26 XP_013452879.1 pentatricopeptide (PPR) repeat protein [Medicago ... 112 2e-26 XP_013452843.1 pentatricopeptide (PPR) repeat protein [Medicago ... 107 2e-26 KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] 107 2e-26 XP_013452888.1 PPR containing plant-like protein [Medicago trunc... 106 3e-26 XP_013452886.1 pentatricopeptide (PPR) repeat protein [Medicago ... 112 3e-26 KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] 108 3e-26 XP_016186450.1 PREDICTED: putative pentatricopeptide repeat-cont... 112 4e-26 XP_004515968.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 5e-26 XP_012570642.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 6e-26 XP_013441668.1 pentatricopeptide (PPR) repeat protein [Medicago ... 108 7e-26 XP_013452876.1 pentatricopeptide (PPR) repeat protein [Medicago ... 110 7e-26 XP_013452884.1 pentatricopeptide (PPR) repeat protein [Medicago ... 107 8e-26 >XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26915.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 103 Score = 112 bits (280), Expect = 2e-29 Identities = 54/76 (71%), Positives = 66/76 (86%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YTVMI+G C+ GLFDEALALLSKME+NGCIP+A TYE II +L EKDEN Sbjct: 28 LVKGYNLDVYAYTVMIQGFCDKGLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 87 Query: 262 YKAKKLVREMIVRGLL 215 A+KL+REMI+RGLL Sbjct: 88 DMAEKLLREMIMRGLL 103 >XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] XP_014624499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] KHN31545.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH09154.1 hypothetical protein GLYMA_16G199700 [Glycine max] Length = 556 Score = 118 bits (295), Expect = 3e-28 Identities = 58/76 (76%), Positives = 65/76 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 LI+GYHLD +YTVMI G C GLFDEALALLSKMEDNGCIPNA+T++ II AL EKDEN Sbjct: 481 LIKGYHLDIRTYTVMISGFCKAGLFDEALALLSKMEDNGCIPNAITFDIIICALFEKDEN 540 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMI RGLL Sbjct: 541 DKAEKLLREMIARGLL 556 >GAU35738.1 hypothetical protein TSUD_370030 [Trifolium subterraneum] Length = 426 Score = 115 bits (289), Expect = 7e-28 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 LI+GY++ +YT+MI GLC +GLFDEA LLSKMEDNGCIPNA+TY+TIIYAL E DEN Sbjct: 351 LIKGYNMTVQTYTIMINGLCLEGLFDEAAVLLSKMEDNGCIPNAITYQTIIYALFENDEN 410 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMI RGLL Sbjct: 411 DKAEKLLREMIARGLL 426 >GAU22521.1 hypothetical protein TSUD_296410 [Trifolium subterraneum] Length = 462 Score = 115 bits (288), Expect = 1e-27 Identities = 54/76 (71%), Positives = 66/76 (86%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YT+MIKG CN GLFDEAL +LSKM+DNGCIP+A TYE +I +L EKDEN Sbjct: 387 LVKGYNLDVHTYTIMIKGFCNKGLFDEALTMLSKMKDNGCIPDAKTYEVLILSLFEKDEN 446 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMIVRGLL Sbjct: 447 DKAEKLLREMIVRGLL 462 >XP_004514199.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012575233.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 252 Score = 111 bits (277), Expect = 2e-27 Identities = 52/76 (68%), Positives = 65/76 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YT+MI+G CN GL DEAL L SKM+DNGCIP+ALTYE +I++L EK EN Sbjct: 177 LVKGYNLDVYAYTIMIQGFCNKGLLDEALDLFSKMKDNGCIPDALTYEIVIHSLFEKYEN 236 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMIVRGLL Sbjct: 237 EKAEKLLREMIVRGLL 252 >XP_012575234.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Cicer arietinum] Length = 147 Score = 107 bits (268), Expect = 4e-27 Identities = 51/76 (67%), Positives = 64/76 (84%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YT+MI+G CN GL DEAL L SKM+DNGCIP+ALTYE +I++L EK E Sbjct: 72 LVKGYNLDVYAYTIMIQGFCNKGLLDEALDLFSKMKDNGCIPDALTYEIVIHSLFEKYEI 131 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMIVRGLL Sbjct: 132 EKAEKLLREMIVRGLL 147 >XP_003619805.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES76023.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 548 Score = 113 bits (283), Expect = 1e-26 Identities = 54/76 (71%), Positives = 65/76 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YTVMI+G C+ G FD+ALALLSKMEDNGCIPNA TYE +I +L EKDEN Sbjct: 473 LVKGYNLDVYAYTVMIQGFCDKGFFDKALALLSKMEDNGCIPNAKTYELVILSLFEKDEN 532 Query: 262 YKAKKLVREMIVRGLL 215 A+KL+REMIVRGLL Sbjct: 533 DTAEKLLREMIVRGLL 548 >XP_004504486.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cicer arietinum] XP_004504487.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cicer arietinum] Length = 550 Score = 113 bits (282), Expect = 2e-26 Identities = 52/76 (68%), Positives = 65/76 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YT+MI+G CN GL DEAL L SKM+DNGCIPNALTYE +I++L EKDEN Sbjct: 475 LVKGYNLDVYTYTIMIQGFCNKGLLDEALDLFSKMKDNGCIPNALTYEIVIHSLFEKDEN 534 Query: 262 YKAKKLVREMIVRGLL 215 KA+ L++EMIVRGLL Sbjct: 535 EKAENLLQEMIVRGLL 550 >XP_013452879.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26907.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 457 Score = 112 bits (280), Expect = 2e-26 Identities = 54/76 (71%), Positives = 66/76 (86%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YTVMI+G C+ GLFDEALALLSKME+NGCIP+A TYE II +L EKDEN Sbjct: 314 LVKGYNLDVYAYTVMIQGFCDKGLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 373 Query: 262 YKAKKLVREMIVRGLL 215 A+KL+REMI+RGLL Sbjct: 374 DMAEKLLREMIMRGLL 389 >XP_013452843.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26871.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 190 Score = 107 bits (266), Expect = 2e-26 Identities = 52/75 (69%), Positives = 63/75 (84%) Frame = -2 Query: 439 IEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDENY 260 ++GY+LD +YTVMI+G C GLF+EALALLSKMEDNGCIP+A TYE II +L +KDEN Sbjct: 116 VKGYNLDVYAYTVMIQGFCVKGLFNEALALLSKMEDNGCIPDAKTYEIIILSLFKKDEND 175 Query: 259 KAKKLVREMIVRGLL 215 A+KL+REMI RGLL Sbjct: 176 MAEKLLREMIARGLL 190 >KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] Length = 207 Score = 107 bits (267), Expect = 2e-26 Identities = 50/76 (65%), Positives = 62/76 (81%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY ++ +YT+MI GLCN GL DEALA+LSKMED GCIPNA+T+E +I AL EKD N Sbjct: 132 LVKGYRINVYTYTIMINGLCNQGLLDEALAMLSKMEDKGCIPNAVTFEILICALFEKDGN 191 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+ EMI RGLL Sbjct: 192 DKAEKLLHEMIARGLL 207 >XP_013452888.1 PPR containing plant-like protein [Medicago truncatula] KEH26916.1 PPR containing plant-like protein [Medicago truncatula] Length = 181 Score = 106 bits (265), Expect = 3e-26 Identities = 51/74 (68%), Positives = 63/74 (85%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YTVMI+G C+ LFDEALALLSKME+NGCIP+A TYE II +L EKDEN Sbjct: 104 LVKGYNLDVYAYTVMIQGFCDKDLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 163 Query: 262 YKAKKLVREMIVRG 221 A+KL+REMI+RG Sbjct: 164 DMAEKLLREMILRG 177 >XP_013452886.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26914.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 501 Score = 112 bits (280), Expect = 3e-26 Identities = 54/76 (71%), Positives = 66/76 (86%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YTVMI+G C+ GLFDEALALLSKME+NGCIP+A TYE II +L EKDEN Sbjct: 426 LVKGYNLDVYAYTVMIQGFCDKGLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 485 Query: 262 YKAKKLVREMIVRGLL 215 A+KL+REMI+RGLL Sbjct: 486 DMAEKLLREMIMRGLL 501 >KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] Length = 246 Score = 108 bits (269), Expect = 3e-26 Identities = 52/76 (68%), Positives = 62/76 (81%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 LI+GYHL+ +Y VMI GLC +GLFDEALA+ SKMEDNGCIPN +T+E II AL E DE Sbjct: 171 LIKGYHLNVWTYNVMISGLCKEGLFDEALAMKSKMEDNGCIPNVVTFERIICALFETDEK 230 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMI +GLL Sbjct: 231 DKAEKLLREMIAKGLL 246 >XP_016186450.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 500 Score = 112 bits (279), Expect = 4e-26 Identities = 54/75 (72%), Positives = 65/75 (86%) Frame = -2 Query: 439 IEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDENY 260 I+GYHL+T +YTVMI GLCN+GL DEALAL+S+MED+GC PNA+TYETII AL+EK EN Sbjct: 423 IKGYHLNTRTYTVMINGLCNEGLLDEALALMSEMEDHGCSPNAVTYETIIRALLEKGEND 482 Query: 259 KAKKLVREMIVRGLL 215 +A K +REMI RGLL Sbjct: 483 RALKYLREMIARGLL 497 >XP_004515968.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012567429.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 346 Score = 109 bits (273), Expect = 5e-26 Identities = 51/76 (67%), Positives = 64/76 (84%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY+LD +YT+MI+G CN GL DEAL L SKM+DNGCIP+ LTYE +I++L EK EN Sbjct: 271 LVKGYNLDVYAYTIMIQGFCNKGLLDEALDLFSKMKDNGCIPDVLTYEIVIHSLFEKYEN 330 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMIVRGLL Sbjct: 331 EKAEKLLREMIVRGLL 346 >XP_012570642.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Cicer arietinum] Length = 280 Score = 108 bits (269), Expect = 6e-26 Identities = 52/76 (68%), Positives = 61/76 (80%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY LD +Y VMI+G CN GL DEAL L SKM+DNGCIPN LTYE II +L + DEN Sbjct: 205 LLKGYDLDVCTYNVMIQGFCNKGLLDEALDLFSKMKDNGCIPNVLTYEIIILSLFKSDEN 264 Query: 262 YKAKKLVREMIVRGLL 215 KAK+L+REMIVRGLL Sbjct: 265 EKAKELLREMIVRGLL 280 >XP_013441668.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH15693.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 320 Score = 108 bits (271), Expect = 7e-26 Identities = 52/76 (68%), Positives = 63/76 (82%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 LI+GY + +YT+MI GLC +GLFDEA+ LL KMEDNGCIPNA+TY TII+AL + DEN Sbjct: 245 LIKGYKVTLWTYTIMINGLCLEGLFDEAMTLLEKMEDNGCIPNAVTYATIIHALFKNDEN 304 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMI RGLL Sbjct: 305 DKAEKLLREMIARGLL 320 >XP_013452876.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26904.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 389 Score = 110 bits (274), Expect = 7e-26 Identities = 53/76 (69%), Positives = 63/76 (82%) Frame = -2 Query: 442 LIEGYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDEN 263 L++GY++ +YTVMI G CN GLFDEALALLSKM+DN C PNALTYE II +L +KDEN Sbjct: 314 LVKGYNITVNTYTVMIHGFCNKGLFDEALALLSKMKDNSCFPNALTYEIIIRSLFDKDEN 373 Query: 262 YKAKKLVREMIVRGLL 215 KA+KL+REMI RGLL Sbjct: 374 DKAEKLLREMITRGLL 389 >XP_013452884.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26912.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 276 Score = 107 bits (268), Expect = 8e-26 Identities = 52/73 (71%), Positives = 62/73 (84%) Frame = -2 Query: 433 GYHLDTISYTVMIKGLCNDGLFDEALALLSKMEDNGCIPNALTYETIIYALVEKDENYKA 254 GY+LD +YTVMI+G C+ GLFDE LALLSKME+NGCIP+A TYE II +L EKDEN A Sbjct: 204 GYNLDVYAYTVMIQGFCDKGLFDEVLALLSKMEENGCIPDAKTYEIIILSLFEKDENDMA 263 Query: 253 KKLVREMIVRGLL 215 +KL+REMI+RGLL Sbjct: 264 EKLLREMIMRGLL 276