BLASTX nr result
ID: Glycyrrhiza32_contig00030343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030343 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 76 1e-14 KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] 76 1e-14 XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 76 1e-14 XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine ma... 73 2e-13 KYP51297.1 Tubby-like F-box protein 5 [Cajanus cajan] 73 2e-13 KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] 73 2e-13 XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 ... 73 2e-13 XP_007160744.1 hypothetical protein PHAVU_001G013500g [Phaseolus... 71 6e-13 XP_017430472.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 71 6e-13 XP_004499167.1 PREDICTED: tubby-like F-box protein 5 [Cicer arie... 70 2e-12 XP_014504786.1 PREDICTED: tubby-like F-box protein 5 [Vigna radi... 70 2e-12 XP_019436910.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 68 7e-12 XP_013466123.1 tubby-F-box-like protein [Medicago truncatula] KE... 68 1e-11 XP_019436911.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 67 3e-11 XP_003589399.2 tubby-F-box-like protein [Medicago truncatula] AE... 63 9e-11 XP_019458176.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 62 1e-09 XP_015947306.1 PREDICTED: tubby-like F-box protein 5 [Arachis du... 57 6e-08 XP_016163210.1 PREDICTED: tubby-like F-box protein 5 [Arachis ip... 55 2e-07 >XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Glycine max] KRH05838.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 448 Score = 76.3 bits (186), Expect = 1e-14 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +2 Query: 41 LSTPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 ++TP+ IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 7 ITTPI-IMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 55 >KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 452 Score = 76.3 bits (186), Expect = 1e-14 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = +2 Query: 44 STPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 ST IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 11 STTPIIMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 59 >XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Glycine max] KRH05837.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 454 Score = 76.3 bits (186), Expect = 1e-14 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = +2 Query: 44 STPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 ST IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 13 STTPIIMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 61 >XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595928.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595929.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595930.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] KHN20970.1 Tubby-like F-box protein 5 [Glycine soja] KRH15179.1 hypothetical protein GLYMA_14G073500 [Glycine max] KRH15180.1 hypothetical protein GLYMA_14G073500 [Glycine max] Length = 423 Score = 72.8 bits (177), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 43 >KYP51297.1 Tubby-like F-box protein 5 [Cajanus cajan] Length = 424 Score = 72.8 bits (177), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 43 >KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] Length = 436 Score = 72.8 bits (177), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 43 >XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 [Glycine max] KRH05839.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 436 Score = 72.8 bits (177), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPECS 43 >XP_007160744.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] XP_007160745.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] ESW32738.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] ESW32739.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] Length = 429 Score = 71.2 bits (173), Expect = 6e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGE K + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPECS 43 >XP_017430472.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Vigna angularis] KOM49157.1 hypothetical protein LR48_Vigan07g286100 [Vigna angularis] BAT82765.1 hypothetical protein VIGAN_03282400 [Vigna angularis var. angularis] Length = 434 Score = 71.2 bits (173), Expect = 6e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SIVRELKE+GEGI NMYRR GGE K + HRHGKSHIAPECS Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPECS 43 >XP_004499167.1 PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] XP_012570834.1 PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] Length = 420 Score = 70.1 bits (170), Expect = 2e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M+ KSIVRE+KEMGEGIGNMYRR G E+K + HRHGKSHIAPECS Sbjct: 1 MSLKSIVREIKEMGEGIGNMYRR-GVESKHM--HRHGKSHIAPECS 43 >XP_014504786.1 PREDICTED: tubby-like F-box protein 5 [Vigna radiata var. radiata] Length = 434 Score = 70.1 bits (170), Expect = 2e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M F+SI+RELKE+GEGI NMYRR GGE K + HRHGKSHIAPECS Sbjct: 1 MPFRSILRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPECS 43 >XP_019436910.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] Length = 437 Score = 68.2 bits (165), Expect = 7e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 53 LFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 L +M+FKSI RELK+MGEGIGNMYR+ G EAK + H +GKSHIAPECS Sbjct: 10 LIMMSFKSIFRELKDMGEGIGNMYRK-GAEAKHM--HLYGKSHIAPECS 55 >XP_013466123.1 tubby-F-box-like protein [Medicago truncatula] KEH40162.1 tubby-F-box-like protein [Medicago truncatula] Length = 422 Score = 67.8 bits (164), Expect = 1e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M FKSIV+ELKEM EGIGNMYRR G E K + HRHGKSHIAPECS Sbjct: 1 MPFKSIVKELKEMKEGIGNMYRR-GVETKHM--HRHGKSHIAPECS 43 >XP_019436911.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Lupinus angustifolius] Length = 426 Score = 66.6 bits (161), Expect = 3e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 59 IMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 +M+FKSI RELK+MGEGIGNMYR+ G EAK + H +GKSHIAPECS Sbjct: 1 MMSFKSIFRELKDMGEGIGNMYRK-GAEAKHM--HLYGKSHIAPECS 44 >XP_003589399.2 tubby-F-box-like protein [Medicago truncatula] AES59650.2 tubby-F-box-like protein [Medicago truncatula] Length = 159 Score = 62.8 bits (151), Expect = 9e-11 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +2 Query: 62 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 M FKSIVRE+KEM EGIGNMY R + + HRHGKSHIAPECS Sbjct: 1 MPFKSIVREIKEMKEGIGNMYIR---DVETKHTHRHGKSHIAPECS 43 >XP_019458176.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] XP_019458177.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] OIW03497.1 hypothetical protein TanjilG_31010 [Lupinus angustifolius] Length = 424 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +2 Query: 59 IMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPECS 199 +M F++IV ELK++GEGIGNMYR+ G E+K + H HGKSHIAPECS Sbjct: 1 MMPFRTIVYELKDIGEGIGNMYRK-GAESKHM--HWHGKSHIAPECS 44 >XP_015947306.1 PREDICTED: tubby-like F-box protein 5 [Arachis duranensis] Length = 453 Score = 57.0 bits (136), Expect = 6e-08 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 5/48 (10%) Frame = +2 Query: 71 KSIVRELKEMGEGIGNMYRRGGGEAKPI-----MHHRHGKSHIAPECS 199 K+IV+ELKE+GE I NMYR HHRHGKSHIAPECS Sbjct: 6 KNIVKELKEIGESISNMYRNNNNNKHNAHHHHHHHHRHGKSHIAPECS 53 >XP_016163210.1 PREDICTED: tubby-like F-box protein 5 [Arachis ipaensis] Length = 455 Score = 55.5 bits (132), Expect = 2e-07 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 5/48 (10%) Frame = +2 Query: 71 KSIVRELKEMGEGIGNMYRRGGGEA--KPIMHH---RHGKSHIAPECS 199 K+IV+ELKE+GE I NMYR K +HH RHGKSHIAPECS Sbjct: 6 KNIVKELKEIGESISNMYRNNNNNNNNKHSVHHHHYRHGKSHIAPECS 53