BLASTX nr result
ID: Glycyrrhiza32_contig00030274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030274 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018852839.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 8e-06 >XP_018852839.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Juglans regia] XP_018858034.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Juglans regia] XP_018858350.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Juglans regia] XP_018805628.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Juglans regia] Length = 705 Score = 52.0 bits (123), Expect = 8e-06 Identities = 39/86 (45%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = +2 Query: 2 LCSSPSSSFCDLKHMTTPISSSYSLINLKLPNF-RPSHKLFPLNPQSKTFLQQPTFSSSQ 178 LCSSPSS F D + + +SSS I L F +PS PL PQ KT Q SS Q Sbjct: 5 LCSSPSSLFNDRQPFGSSLSSSRKPILRSLTFFFKPS----PLQPQPKTLFQIRHVSSIQ 60 Query: 179 DTIPQVTQSSNSLEDATELDDPDAKS 256 D IPQ TQ ++ ED + PD KS Sbjct: 61 DPIPQETQKASPSED-SNTKYPDGKS 85