BLASTX nr result
ID: Glycyrrhiza32_contig00030247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030247 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019455958.1 PREDICTED: aspartyl protease family protein 2-lik... 65 3e-10 XP_007141420.1 hypothetical protein PHAVU_008G193900g [Phaseolus... 64 8e-10 GAU12325.1 hypothetical protein TSUD_252760 [Trifolium subterran... 62 4e-09 KOM46455.1 hypothetical protein LR48_Vigan07g015900 [Vigna angul... 62 5e-09 KRH73625.1 hypothetical protein GLYMA_02G284800 [Glycine max] 62 5e-09 XP_014618556.1 PREDICTED: uncharacterized protein LOC100527007 i... 62 5e-09 XP_014502930.1 PREDICTED: aspartic proteinase nepenthesin-1 [Vig... 62 5e-09 XP_017428469.1 PREDICTED: LOW QUALITY PROTEIN: aspartic proteina... 62 5e-09 XP_002520371.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ric... 61 9e-09 KYP34544.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] 60 2e-08 XP_003617399.2 eukaryotic aspartyl protease family protein [Medi... 60 2e-08 KHN11976.1 Aspartic proteinase nepenthesin-1 [Glycine soja] 60 2e-08 KHN38336.1 Aspartic proteinase nepenthesin-2 [Glycine soja] 60 2e-08 KRH14503.1 hypothetical protein GLYMA_14G030000 [Glycine max] 60 2e-08 XP_006595492.1 PREDICTED: uncharacterized protein LOC100305604 i... 60 2e-08 KYP34990.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] 60 3e-08 XP_016164032.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ara... 60 3e-08 XP_015973158.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ara... 60 3e-08 KHN35897.1 Aspartic proteinase nepenthesin-2 [Glycine soja] 59 8e-08 XP_014634873.1 PREDICTED: aspartic proteinase nepenthesin-1-like... 59 8e-08 >XP_019455958.1 PREDICTED: aspartyl protease family protein 2-like [Lupinus angustifolius] XP_019455959.1 PREDICTED: aspartyl protease family protein 2-like [Lupinus angustifolius] OIW04204.1 hypothetical protein TanjilG_00764 [Lupinus angustifolius] Length = 556 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMV GEVLEIPEETWHLSEEGA Sbjct: 395 DTFYYVQIKSVMVGGEVLEIPEETWHLSEEGA 426 >XP_007141420.1 hypothetical protein PHAVU_008G193900g [Phaseolus vulgaris] ESW13414.1 hypothetical protein PHAVU_008G193900g [Phaseolus vulgaris] Length = 554 Score = 64.3 bits (155), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVDGEVL+IPEETWHLS EGA Sbjct: 394 DTFYYVQIKSVMVDGEVLKIPEETWHLSAEGA 425 >GAU12325.1 hypothetical protein TSUD_252760 [Trifolium subterraneum] Length = 491 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY IKS+MVDGEVL+IPEETWHLSEEG+ Sbjct: 331 DTFYYVGIKSIMVDGEVLKIPEETWHLSEEGS 362 >KOM46455.1 hypothetical protein LR48_Vigan07g015900 [Vigna angularis] BAT80779.1 hypothetical protein VIGAN_03037900 [Vigna angularis var. angularis] Length = 554 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVDGE L+IPEETWHLS EGA Sbjct: 394 DTFYYVQIKSVMVDGEELKIPEETWHLSAEGA 425 >KRH73625.1 hypothetical protein GLYMA_02G284800 [Glycine max] Length = 561 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVD EVL+IPEETWHLS EGA Sbjct: 401 DTFYYVQIKSVMVDDEVLKIPEETWHLSSEGA 432 >XP_014618556.1 PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine max] Length = 746 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVD EVL+IPEETWHLS EGA Sbjct: 401 DTFYYVQIKSVMVDDEVLKIPEETWHLSSEGA 432 >XP_014502930.1 PREDICTED: aspartic proteinase nepenthesin-1 [Vigna radiata var. radiata] Length = 757 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVDGE L+IPEETWHLS EGA Sbjct: 394 DTFYYVQIKSVMVDGEELKIPEETWHLSAEGA 425 >XP_017428469.1 PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase nepenthesin-1 [Vigna angularis] Length = 758 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKSVMVDGE L+IPEETWHLS EGA Sbjct: 394 DTFYYVQIKSVMVDGEELKIPEETWHLSAEGA 425 >XP_002520371.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ricinus communis] EEF41987.1 basic 7S globulin 2 precursor small subunit, putative [Ricinus communis] Length = 557 Score = 61.2 bits (147), Expect = 9e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKS+MV GEVL+IPEETWHLS EGA Sbjct: 396 DTFYYVQIKSIMVGGEVLKIPEETWHLSPEGA 427 >KYP34544.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] Length = 546 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY +IKSVMVD EVL+IPEETWHLS EGA Sbjct: 386 DTFYYVEIKSVMVDDEVLKIPEETWHLSAEGA 417 >XP_003617399.2 eukaryotic aspartyl protease family protein [Medicago truncatula] AET00358.2 eukaryotic aspartyl protease family protein [Medicago truncatula] Length = 556 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEG 43 DTFYY IKS+MVDGEVL+IPEETWHLS+EG Sbjct: 396 DTFYYVGIKSIMVDGEVLKIPEETWHLSKEG 426 >KHN11976.1 Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 559 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QI SVMVD EVL+IPEETWHLS EGA Sbjct: 399 DTFYYVQINSVMVDDEVLKIPEETWHLSSEGA 430 >KHN38336.1 Aspartic proteinase nepenthesin-2 [Glycine soja] Length = 560 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QI SVMVD EVL+IPEETWHLS EGA Sbjct: 400 DTFYYVQINSVMVDDEVLKIPEETWHLSSEGA 431 >KRH14503.1 hypothetical protein GLYMA_14G030000 [Glycine max] Length = 731 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QI SVMVD EVL+IPEETWHLS EGA Sbjct: 399 DTFYYVQINSVMVDDEVLKIPEETWHLSSEGA 430 >XP_006595492.1 PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine max] Length = 753 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QI SVMVD EVL+IPEETWHLS EGA Sbjct: 399 DTFYYVQINSVMVDDEVLKIPEETWHLSSEGA 430 >KYP34990.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] Length = 551 Score = 59.7 bits (143), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEG 43 DTFYY QIKS+MV GEVL+IPEETWHLS EG Sbjct: 390 DTFYYVQIKSIMVGGEVLKIPEETWHLSAEG 420 >XP_016164032.1 PREDICTED: aspartic proteinase nepenthesin-1 [Arachis ipaensis] Length = 754 Score = 59.7 bits (143), Expect = 3e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKS+MVDGEVL+IPEETW+LS +GA Sbjct: 392 DTFYYVQIKSLMVDGEVLDIPEETWNLSAQGA 423 >XP_015973158.1 PREDICTED: aspartic proteinase nepenthesin-1 [Arachis duranensis] Length = 756 Score = 59.7 bits (143), Expect = 3e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEGA 40 DTFYY QIKS+MVDGEVL+IPEETW+LS +GA Sbjct: 395 DTFYYVQIKSLMVDGEVLDIPEETWNLSAQGA 426 >KHN35897.1 Aspartic proteinase nepenthesin-2 [Glycine soja] Length = 530 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEG 43 DTFYY QIKS+MV GEVL+IPEETWHLS +G Sbjct: 369 DTFYYVQIKSIMVGGEVLKIPEETWHLSAQG 399 >XP_014634873.1 PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] KRH46018.1 hypothetical protein GLYMA_08G307600 [Glycine max] Length = 557 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 135 DTFYYAQIKSVMVDGEVLEIPEETWHLSEEG 43 DTFYY QIKS+MV GEVL+IPEETWHLS +G Sbjct: 395 DTFYYVQIKSIMVGGEVLKIPEETWHLSAQG 425