BLASTX nr result
ID: Glycyrrhiza32_contig00030187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00030187 (505 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004492958.1 PREDICTED: probable receptor protein kinase TMK1 ... 57 3e-06 >XP_004492958.1 PREDICTED: probable receptor protein kinase TMK1 [Cicer arietinum] Length = 864 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 400 ADDDAVYMSKLLKALTPTPVGWSENSTDFCQWNGV 504 AD++A YMSKLLKALTPTP GWS N +C WNGV Sbjct: 23 ADEEADYMSKLLKALTPTPTGWSHN-VSYCNWNGV 56