BLASTX nr result
ID: Glycyrrhiza32_contig00029977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029977 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 1e-42 XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 4e-35 XP_013456164.1 PPR containing plant-like protein [Medicago trunc... 130 4e-35 XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 3e-34 KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870... 127 6e-34 XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 i... 122 3e-32 GAU45009.1 hypothetical protein TSUD_88000 [Trifolium subterraneum] 118 1e-30 XP_017406349.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 4e-30 XP_014493356.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 3e-29 XP_007132030.1 hypothetical protein PHAVU_011G060800g [Phaseolus... 114 5e-29 XP_015952210.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 2e-28 XP_016187211.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 4e-28 XP_004145279.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 2e-26 XP_008457435.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 5e-26 XP_004291520.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 9e-26 XP_012066943.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 1e-25 XP_010106566.1 hypothetical protein L484_025326 [Morus notabilis... 106 2e-25 KDP42187.1 hypothetical protein JCGZ_02917 [Jatropha curcas] 104 4e-25 XP_008386010.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 8e-25 XP_010043480.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 1e-24 >XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cicer arietinum] Length = 261 Score = 149 bits (376), Expect = 1e-42 Identities = 76/106 (71%), Positives = 83/106 (78%), Gaps = 5/106 (4%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVS--TRSSKPIRDASTPLMPSRP---FQCRRLWGFRE 210 MASRCFM+KWE RLASV+L E S TR S IRD ST L + F+ + +WGFRE Sbjct: 1 MASRCFMRKWETCRLASVFLTELTSNSTRCSNLIRDVSTALSSTHSIAMFEPKSVWGFRE 60 Query: 211 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKD+ED LHKFIK HV Sbjct: 61 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDEEDTLHKFIKTHV 106 >XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Glycine max] KRH29734.1 hypothetical protein GLYMA_11G135100 [Glycine max] Length = 255 Score = 130 bits (326), Expect = 4e-35 Identities = 67/102 (65%), Positives = 76/102 (74%), Gaps = 1/102 (0%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQC-RRLWGFREYHDG 222 MASR F+K W+I AS+ LGEF TRS KPI+D S+ + F + FR+YHDG Sbjct: 1 MASRSFLKNWKILDFASLLLGEF--TRSIKPIKDVSSTSLTFVEFNSFKTALCFRQYHDG 58 Query: 223 RPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 RPRGPLW+GKKLIGKEALFVISG KRF DDEDKLHKFIK HV Sbjct: 59 RPRGPLWKGKKLIGKEALFVISGFKRFNDDEDKLHKFIKTHV 100 >XP_013456164.1 PPR containing plant-like protein [Medicago truncatula] KEH30195.1 PPR containing plant-like protein [Medicago truncatula] Length = 261 Score = 130 bits (326), Expect = 4e-35 Identities = 65/106 (61%), Positives = 79/106 (74%), Gaps = 5/106 (4%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVS--TRSSKPIRDASTPLMPSR---PFQCRRLWGFRE 210 MA RC ++KW+ RL S +L +F S T++ PIRD S+ L + F+ + + GFRE Sbjct: 1 MALRCILRKWKTHRLTSSFLTQFTSNPTKTINPIRDISSALSSTHFITSFEHKNVTGFRE 60 Query: 211 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 YHDGRPRGPLWRGKKLIGKEAL+VISGLKRFKDDE+KL KFI HV Sbjct: 61 YHDGRPRGPLWRGKKLIGKEALYVISGLKRFKDDEEKLPKFITTHV 106 >XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] XP_019454099.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] OIW05740.1 hypothetical protein TanjilG_23526 [Lupinus angustifolius] Length = 254 Score = 127 bits (320), Expect = 3e-34 Identities = 64/102 (62%), Positives = 75/102 (73%), Gaps = 1/102 (0%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRL-WGFREYHDG 222 MA+R F KKW L S +L + TR+ PI+ +S+ FQC+ + WG REYHDG Sbjct: 1 MATRSFFKKWRFPHLVSPFLNQL--TRTPNPIKQSSST-SDVAVFQCKTVSWGLREYHDG 57 Query: 223 RPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 RPRGPLW+GKKLIGKEALFVI GLKRFKDDEDK+ KFIKNHV Sbjct: 58 RPRGPLWKGKKLIGKEALFVILGLKRFKDDEDKIQKFIKNHV 99 >KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870 family [Cajanus cajan] Length = 257 Score = 127 bits (318), Expect = 6e-34 Identities = 71/104 (68%), Positives = 77/104 (74%), Gaps = 3/104 (2%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDAST--PLMP-SRPFQCRRLWGFREYH 216 MA R F K++IR L SV +GEF TRS KPI+DAST PL+ S + R YH Sbjct: 1 MAFRSFSNKFKIRDLGSVIVGEF--TRSRKPIKDASTSMPLVAVSESNWFKTASWLRHYH 58 Query: 217 DGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 DGRPRGPLWRGKKLIGKEALFVI GLKRFKDDEDKLHKFIK HV Sbjct: 59 DGRPRGPLWRGKKLIGKEALFVIIGLKRFKDDEDKLHKFIKTHV 102 >XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 isoform X1 [Glycine max] KHN25233.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH24725.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24726.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24727.1 hypothetical protein GLYMA_12G058700 [Glycine max] Length = 255 Score = 122 bits (307), Expect = 3e-32 Identities = 67/104 (64%), Positives = 75/104 (72%), Gaps = 3/104 (2%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIR---DASTPLMPSRPFQCRRLWGFREYH 216 MASR F K + R LAS+ L EF TRSSKPI+ S+P + F+ FR+YH Sbjct: 1 MASRSFFKNLKNRDLASLLLVEF--TRSSKPIKHISSTSSPFVECNSFKTASC--FRQYH 56 Query: 217 DGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 DGRPRGPLW+GKKLIGKEALFVISG KRF DDEDKLHKFIK HV Sbjct: 57 DGRPRGPLWKGKKLIGKEALFVISGFKRFNDDEDKLHKFIKTHV 100 >GAU45009.1 hypothetical protein TSUD_88000 [Trifolium subterraneum] Length = 261 Score = 118 bits (296), Expect = 1e-30 Identities = 64/108 (59%), Positives = 73/108 (67%), Gaps = 7/108 (6%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW-------GF 204 MA RC M+KWE R AS++L +T IRD + + R ++ GF Sbjct: 1 MAIRCLMRKWETCRKASIFLTS--NTTPLTIIRDNISSALSLRHIVASSVFEYKNVCVGF 58 Query: 205 REYHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 REYHDGRPRGPLWRGKKLIGKEAL+VISGLKRFKDDEDKL KFIK HV Sbjct: 59 REYHDGRPRGPLWRGKKLIGKEALYVISGLKRFKDDEDKLPKFIKTHV 106 >XP_017406349.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna angularis] XP_017406350.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna angularis] KOM26232.1 hypothetical protein LR48_Vigan238s006500 [Vigna angularis] BAT90758.1 hypothetical protein VIGAN_06204100 [Vigna angularis var. angularis] Length = 254 Score = 117 bits (292), Expect = 4e-30 Identities = 64/103 (62%), Positives = 74/103 (71%), Gaps = 2/103 (1%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 219 MASR F K +I S+ +G+ TR++K I S PL + S F+ W R+YHD Sbjct: 1 MASRSFSKVRKICDFGSLLVGQL--TRATKLIEHGSAPLPFVESTSFKTASCW--RQYHD 56 Query: 220 GRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 GRPRGPLWRGKKLIGKEALFVI GLKRFKDDEDKLHKFIK+HV Sbjct: 57 GRPRGPLWRGKKLIGKEALFVILGLKRFKDDEDKLHKFIKSHV 99 >XP_014493356.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna radiata var. radiata] Length = 254 Score = 114 bits (286), Expect = 3e-29 Identities = 63/103 (61%), Positives = 73/103 (70%), Gaps = 2/103 (1%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 219 MASR F K +I S+ +G+ TR++K I S PL + S + W R+YHD Sbjct: 1 MASRSFSKVRKICDFGSLLVGQL--TRATKLIEHCSAPLPFVESTSLKTASCW--RQYHD 56 Query: 220 GRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 GRPRGPLWRGKKLIGKEALFVI GLKRFKDDEDKLHKFIK+HV Sbjct: 57 GRPRGPLWRGKKLIGKEALFVILGLKRFKDDEDKLHKFIKSHV 99 >XP_007132030.1 hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris] ESW04024.1 hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris] Length = 254 Score = 114 bits (285), Expect = 5e-29 Identities = 61/103 (59%), Positives = 73/103 (70%), Gaps = 2/103 (1%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 219 MA R F K W+I S+ + F TR++K I+ AS PL + S F+ W R YHD Sbjct: 1 MAGRSFSKVWKICDFGSLLVPHF--TRTTKLIKHASPPLSFLQSNSFKTPSFW--RLYHD 56 Query: 220 GRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 GRPRGPLW+GKKLIGKEALFV+ GLKRFKDD+DKL KFIK+HV Sbjct: 57 GRPRGPLWKGKKLIGKEALFVVLGLKRFKDDQDKLQKFIKSHV 99 >XP_015952210.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Arachis duranensis] XP_015952212.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Arachis duranensis] Length = 259 Score = 113 bits (282), Expect = 2e-28 Identities = 62/104 (59%), Positives = 71/104 (68%), Gaps = 3/104 (2%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS--RPFQCRRLWG-FREYH 216 MASR RL+SV+L F +T ++ +S+ L+P R F + FR YH Sbjct: 1 MASRRCFTMLRRARLSSVFLRHFTTTPNTITHHSSSSLLLPPLLRVFDSAKTASCFRHYH 60 Query: 217 DGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 DGRPRGPLWRGKKLIGKEALFVI GLKRFKDD DKLHKFIKNHV Sbjct: 61 DGRPRGPLWRGKKLIGKEALFVIQGLKRFKDDHDKLHKFIKNHV 104 >XP_016187211.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] XP_016187212.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] XP_016187213.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] Length = 258 Score = 112 bits (279), Expect = 4e-28 Identities = 63/103 (61%), Positives = 69/103 (66%), Gaps = 2/103 (1%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS-RPFQCRRLWG-FREYHD 219 MASR RLASV+L F +T ++ +S L P R F + FR YHD Sbjct: 1 MASRRCFTMLRRARLASVFLRHFTTTPNTITHHSSSLLLPPLLRVFDSAKTASCFRHYHD 60 Query: 220 GRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 GRPRGPLWRGKKLIGKEALFVI GLKRFKDD DKLHKFIKNHV Sbjct: 61 GRPRGPLWRGKKLIGKEALFVIQGLKRFKDDHDKLHKFIKNHV 103 >XP_004145279.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cucumis sativus] KGN65758.1 hypothetical protein Csa_1G525290 [Cucumis sativus] Length = 255 Score = 107 bits (267), Expect = 2e-26 Identities = 51/97 (52%), Positives = 65/97 (67%), Gaps = 4/97 (4%) Frame = +1 Query: 70 KWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS----RPFQCRRLWGFREYHDGRPRGP 237 +W R V+ F+ + +PIRD P+ + +P R +WGFR YHDGRPRGP Sbjct: 4 RWFSRSKLPVFASVFLQGLTRRPIRDVPLPVKSTITDFQPDSRRPIWGFRLYHDGRPRGP 63 Query: 238 LWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 LWR +K IGKEALFVI GLKRFK+DE+K KF+K+HV Sbjct: 64 LWRSRKAIGKEALFVIQGLKRFKEDEEKFEKFMKSHV 100 >XP_008457435.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cucumis melo] Length = 255 Score = 106 bits (265), Expect = 5e-26 Identities = 51/97 (52%), Positives = 66/97 (68%), Gaps = 4/97 (4%) Frame = +1 Query: 70 KWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS----RPFQCRRLWGFREYHDGRPRGP 237 +W R ++ F+ + +PIRD P+ + +P R +WGFR YHDGRPRGP Sbjct: 4 RWFSRSKLPIFALVFLRGLTRRPIRDVPLPVTSTITGFQPDSSRPIWGFRLYHDGRPRGP 63 Query: 238 LWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 LWR +K IGKEALFVI GLKRFK+DE+KL KF+K+HV Sbjct: 64 LWRSRKAIGKEALFVIQGLKRFKEDEEKLGKFMKSHV 100 >XP_004291520.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Fragaria vesca subsp. vesca] Length = 255 Score = 105 bits (263), Expect = 9e-26 Identities = 52/75 (69%), Positives = 58/75 (77%), Gaps = 4/75 (5%) Frame = +1 Query: 136 PIRDASTPLMPSRPFQ----CRRLWGFREYHDGRPRGPLWRGKKLIGKEALFVISGLKRF 303 PIR+ P PS P C+ + GFR YHDGRPRGPLWRGKKLIGKEAL+VISGLKRF Sbjct: 26 PIRENPFPPKPSSPVSQIQSCQPICGFRLYHDGRPRGPLWRGKKLIGKEALYVISGLKRF 85 Query: 304 KDDEDKLHKFIKNHV 348 KDDE+ L KFIK+HV Sbjct: 86 KDDEETLGKFIKSHV 100 >XP_012066943.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] XP_012066944.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] Length = 269 Score = 105 bits (263), Expect = 1e-25 Identities = 58/108 (53%), Positives = 71/108 (65%), Gaps = 6/108 (5%) Frame = +1 Query: 43 VMASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW------GF 204 VMA R F + +I +L++V+L ++ KP S P P + + G Sbjct: 12 VMAVRAFSRS-KIAKLSAVFL----QNQTVKPTIPISLPSKPQISYSDSNILSYSYFCGL 66 Query: 205 REYHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 R+YHDGRPRGPLWRGKKLIGKEALFVI GLKRFKDDE+KL +FIKNHV Sbjct: 67 RQYHDGRPRGPLWRGKKLIGKEALFVIQGLKRFKDDEEKLQRFIKNHV 114 >XP_010106566.1 hypothetical protein L484_025326 [Morus notabilis] EXC10742.1 hypothetical protein L484_025326 [Morus notabilis] Length = 324 Score = 106 bits (265), Expect = 2e-25 Identities = 63/105 (60%), Positives = 70/105 (66%), Gaps = 4/105 (3%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS-RPFQC---RRLWGFREY 213 MASR F + +I LAS T PI+D+ PL F+ R + GFREY Sbjct: 1 MASRAFSRS-KISILASGLFRAIYRT----PIKDSPLPLKSKVSAFETDPWRPVCGFREY 55 Query: 214 HDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 HDGRPRGPLWRGKKLIGKEALFVI GLKRFKDDE+KL KFIK HV Sbjct: 56 HDGRPRGPLWRGKKLIGKEALFVILGLKRFKDDEEKLQKFIKTHV 100 >KDP42187.1 hypothetical protein JCGZ_02917 [Jatropha curcas] Length = 257 Score = 104 bits (259), Expect = 4e-25 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 6/107 (5%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW------GFR 207 MA R F + +I +L++V+L ++ KP S P P + + G R Sbjct: 1 MAVRAFSRS-KIAKLSAVFL----QNQTVKPTIPISLPSKPQISYSDSNILSYSYFCGLR 55 Query: 208 EYHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 +YHDGRPRGPLWRGKKLIGKEALFVI GLKRFKDDE+KL +FIKNHV Sbjct: 56 QYHDGRPRGPLWRGKKLIGKEALFVIQGLKRFKDDEEKLQRFIKNHV 102 >XP_008386010.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Malus domestica] XP_008386011.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Malus domestica] Length = 256 Score = 103 bits (257), Expect = 8e-25 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 6/107 (5%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPF------QCRRLWGFR 207 MA+R F R +S + + + PI+ +TPL+ + CR + GFR Sbjct: 1 MATRAFS-----RSKSSFFSSVLLQNLKTTPIK--TTPLLLNSTIPELEIKSCRPISGFR 53 Query: 208 EYHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKD+E+KL KF+K HV Sbjct: 54 LYHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDNEEKLGKFVKTHV 100 >XP_010043480.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Eucalyptus grandis] XP_018724277.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Eucalyptus grandis] KCW85496.1 hypothetical protein EUGRSUZ_B02297 [Eucalyptus grandis] Length = 255 Score = 103 bits (256), Expect = 1e-24 Identities = 62/106 (58%), Positives = 68/106 (64%), Gaps = 5/106 (4%) Frame = +1 Query: 46 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPF--QCRRL---WGFRE 210 MA R F K + R AS L + P+R +S L P F QC + W R Sbjct: 1 MAGRLFSKS-KFRFFASSLLRNV----NPSPLRGSSLLLKPRAQFLEQCAAMDASW-VRR 54 Query: 211 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEDKLHKFIKNHV 348 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDE+KL KFIK HV Sbjct: 55 YHDGRPRGPLWRGKKLIGKEALFVISGLKRFKDDEEKLQKFIKTHV 100