BLASTX nr result
ID: Glycyrrhiza32_contig00029963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029963 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004488559.1 PREDICTED: protein strawberry notch homolog 1 [Ci... 92 6e-20 XP_015936859.1 PREDICTED: protein strawberry notch [Arachis dura... 92 8e-20 XP_016170072.1 PREDICTED: protein strawberry notch [Arachis ipae... 91 1e-19 OAY26460.1 hypothetical protein MANES_16G049100, partial [Maniho... 91 2e-19 KRH44823.1 hypothetical protein GLYMA_08G233600, partial [Glycin... 89 3e-19 KYP38532.1 Protein strawberry notch isogeny 1 [Cajanus cajan] 90 3e-19 XP_018837138.1 PREDICTED: protein strawberry notch [Juglans regia] 90 3e-19 ONI11795.1 hypothetical protein PRUPE_4G126100 [Prunus persica] 90 3e-19 ONI11796.1 hypothetical protein PRUPE_4G126100 [Prunus persica] 90 3e-19 XP_008225984.1 PREDICTED: protein strawberry notch homolog 1 [Pr... 90 3e-19 XP_007213295.1 hypothetical protein PRUPE_ppa000351mg [Prunus pe... 90 3e-19 ONI11798.1 hypothetical protein PRUPE_4G126100 [Prunus persica] 90 3e-19 KDO61518.1 hypothetical protein CISIN_1g0383973mg, partial [Citr... 89 3e-19 XP_017180652.1 PREDICTED: protein strawberry notch homolog 1-lik... 90 3e-19 XP_019432321.1 PREDICTED: protein strawberry notch isoform X2 [L... 90 4e-19 OIV89831.1 hypothetical protein TanjilG_29766 [Lupinus angustifo... 90 4e-19 XP_009363316.1 PREDICTED: protein strawberry notch isoform X2 [P... 90 4e-19 XP_009363315.1 PREDICTED: protein strawberry notch isoform X1 [P... 90 4e-19 XP_019432320.1 PREDICTED: protein strawberry notch isoform X1 [L... 90 4e-19 XP_012084559.1 PREDICTED: protein strawberry notch homolog 1 [Ja... 89 5e-19 >XP_004488559.1 PREDICTED: protein strawberry notch homolog 1 [Cicer arietinum] Length = 1218 Score = 92.0 bits (227), Expect = 6e-20 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE FL I DLLIQ ARIEGNLDTGIV LKANVIELQGTPKTVYVDQMSGAST Sbjct: 971 LFELFLNIFDLLIQKARIEGNLDTGIVDLKANVIELQGTPKTVYVDQMSGAST 1023 >XP_015936859.1 PREDICTED: protein strawberry notch [Arachis duranensis] Length = 1283 Score = 91.7 bits (226), Expect = 8e-20 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL+QNARIEGNLDTGIV LKANVIELQGTPKTV+VDQM+GAST Sbjct: 1035 LFELFVSILDLLVQNARIEGNLDTGIVDLKANVIELQGTPKTVHVDQMTGAST 1087 >XP_016170072.1 PREDICTED: protein strawberry notch [Arachis ipaensis] Length = 1283 Score = 91.3 bits (225), Expect = 1e-19 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL+QNARIEGNLDTGIV LKAN+IELQGTPKTV+VDQM+GAST Sbjct: 1035 LFELFVSILDLLVQNARIEGNLDTGIVDLKANIIELQGTPKTVHVDQMTGAST 1087 >OAY26460.1 hypothetical protein MANES_16G049100, partial [Manihot esculenta] Length = 610 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLLIQNARIEGNLD+GIV +KAN+IELQGTPKTV+VDQMSGAST Sbjct: 362 LFELFVSILDLLIQNARIEGNLDSGIVDMKANIIELQGTPKTVHVDQMSGAST 414 >KRH44823.1 hypothetical protein GLYMA_08G233600, partial [Glycine max] Length = 341 Score = 89.0 bits (219), Expect = 3e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL++NARIEGNLDTGIV LKANVIELQGTPKTV+VDQ++GAST Sbjct: 102 LFELFVSILDLLVRNARIEGNLDTGIVDLKANVIELQGTPKTVHVDQLTGAST 154 >KYP38532.1 Protein strawberry notch isogeny 1 [Cajanus cajan] Length = 1106 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL++NARIEGNLDTGIV LKANVIELQGTPKTV+VDQM+GAST Sbjct: 858 LFELFVSILDLLVRNARIEGNLDTGIVDLKANVIELQGTPKTVHVDQMTGAST 910 >XP_018837138.1 PREDICTED: protein strawberry notch [Juglans regia] Length = 1247 Score = 90.1 bits (222), Expect = 3e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLLIQNARIEGNLD+GIV +KANVIELQGTPKTV+VDQMSGAST Sbjct: 999 LFELFVGILDLLIQNARIEGNLDSGIVDMKANVIELQGTPKTVHVDQMSGAST 1051 >ONI11795.1 hypothetical protein PRUPE_4G126100 [Prunus persica] Length = 1253 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL+I NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1005 LFECFVSILDLIIHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1057 >ONI11796.1 hypothetical protein PRUPE_4G126100 [Prunus persica] Length = 1254 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL+I NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1006 LFECFVSILDLIIHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1058 >XP_008225984.1 PREDICTED: protein strawberry notch homolog 1 [Prunus mume] Length = 1257 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL+I NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1009 LFECFVSILDLIIHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1061 >XP_007213295.1 hypothetical protein PRUPE_ppa000351mg [Prunus persica] ONI11797.1 hypothetical protein PRUPE_4G126100 [Prunus persica] Length = 1257 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL+I NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1009 LFECFVSILDLIIHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1061 >ONI11798.1 hypothetical protein PRUPE_4G126100 [Prunus persica] Length = 1258 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL+I NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1010 LFECFVSILDLIIHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1062 >KDO61518.1 hypothetical protein CISIN_1g0383973mg, partial [Citrus sinensis] Length = 320 Score = 88.6 bits (218), Expect = 3e-19 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL+QNARIEGNLD+GIV +KAN+IELQGTPKTV+VD MSGAST Sbjct: 254 LFELFISILDLLVQNARIEGNLDSGIVDMKANIIELQGTPKTVHVDNMSGAST 306 >XP_017180652.1 PREDICTED: protein strawberry notch homolog 1-like [Malus domestica] Length = 518 Score = 89.7 bits (221), Expect = 3e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL++ NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 270 LFECFVSILDLIVHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 322 >XP_019432321.1 PREDICTED: protein strawberry notch isoform X2 [Lupinus angustifolius] Length = 1099 Score = 89.7 bits (221), Expect = 4e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ +LDLL+QNARIEGNLD+GIV LKANVIELQGTPKTV+VDQM+GAST Sbjct: 851 LFELFVSVLDLLVQNARIEGNLDSGIVDLKANVIELQGTPKTVHVDQMTGAST 903 >OIV89831.1 hypothetical protein TanjilG_29766 [Lupinus angustifolius] Length = 1202 Score = 89.7 bits (221), Expect = 4e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ +LDLL+QNARIEGNLD+GIV LKANVIELQGTPKTV+VDQM+GAST Sbjct: 943 LFELFVSVLDLLVQNARIEGNLDSGIVDLKANVIELQGTPKTVHVDQMTGAST 995 >XP_009363316.1 PREDICTED: protein strawberry notch isoform X2 [Pyrus x bretschneideri] Length = 1255 Score = 89.7 bits (221), Expect = 4e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL++ NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1007 LFECFVSILDLIVHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1059 >XP_009363315.1 PREDICTED: protein strawberry notch isoform X1 [Pyrus x bretschneideri] Length = 1257 Score = 89.7 bits (221), Expect = 4e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDL++ NARIEGNLD+GIV +KANVIELQGTPKTVYVDQMSGAST Sbjct: 1009 LFECFVSILDLIVHNARIEGNLDSGIVDMKANVIELQGTPKTVYVDQMSGAST 1061 >XP_019432320.1 PREDICTED: protein strawberry notch isoform X1 [Lupinus angustifolius] Length = 1270 Score = 89.7 bits (221), Expect = 4e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ +LDLL+QNARIEGNLD+GIV LKANVIELQGTPKTV+VDQM+GAST Sbjct: 1022 LFELFVSVLDLLVQNARIEGNLDSGIVDLKANVIELQGTPKTVHVDQMTGAST 1074 >XP_012084559.1 PREDICTED: protein strawberry notch homolog 1 [Jatropha curcas] KDP27422.1 hypothetical protein JCGZ_20832 [Jatropha curcas] Length = 1259 Score = 89.4 bits (220), Expect = 5e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 3 IFETFLIILDLLIQNARIEGNLDTGIVGLKANVIELQGTPKTVYVDQMSGAST 161 +FE F+ ILDLL+QNARIEGNLD+GIV +KAN+IELQGTPKTV+VDQMSGAST Sbjct: 1009 LFELFVSILDLLVQNARIEGNLDSGIVDMKANLIELQGTPKTVHVDQMSGAST 1061