BLASTX nr result
ID: Glycyrrhiza32_contig00029854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029854 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024578866.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 70 9e-14 KWV47793.1 hypothetical protein AS156_19350 [Bradyrhizobium sp. ... 66 5e-12 WP_066513654.1 hypothetical protein [Bradyrhizobium sp. BR 10303] 63 6e-11 WP_063675933.1 hypothetical protein [Bradyrhizobium neotropicale... 54 1e-07 >WP_024578866.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU48649.1 hypothetical protein QU41_14180 [Bradyrhizobium elkanii] OCX29353.1 hypothetical protein QU42_20855 [Bradyrhizobium sp. UASWS1016] Length = 83 Score = 70.1 bits (170), Expect = 9e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 110 EVLQSEELPYAPIGSWLQKATVRIIYPDGQTAESTF 3 EVL+SEELPYAPIGSWL KATVRIIYPDGQ AESTF Sbjct: 16 EVLRSEELPYAPIGSWLLKATVRIIYPDGQAAESTF 51 >KWV47793.1 hypothetical protein AS156_19350 [Bradyrhizobium sp. BR 10303] Length = 103 Score = 66.2 bits (160), Expect = 5e-12 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = -2 Query: 203 MKCDTTFALVLGLTVVL-GSXXXXXXXXXXXAEVLQSEELPYAPIGSWLQKATVRIIYPD 27 M+C T ++L L + G+ AEVL+SEELPYAPIGSWL KATVR+ YP Sbjct: 1 MRCGTISGIILCLGIASSGAVSAAAPAGRCRAEVLRSEELPYAPIGSWLLKATVRVTYPH 60 Query: 26 GQTAESTF 3 GQT + TF Sbjct: 61 GQTVDQTF 68 >WP_066513654.1 hypothetical protein [Bradyrhizobium sp. BR 10303] Length = 83 Score = 62.8 bits (151), Expect = 6e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 110 EVLQSEELPYAPIGSWLQKATVRIIYPDGQTAESTF 3 EVL+SEELPYAPIGSWL KATVR+ YP GQT + TF Sbjct: 13 EVLRSEELPYAPIGSWLLKATVRVTYPHGQTVDQTF 48 >WP_063675933.1 hypothetical protein [Bradyrhizobium neotropicale] OAF19991.1 hypothetical protein AXW67_34175 [Bradyrhizobium neotropicale] Length = 86 Score = 54.3 bits (129), Expect = 1e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -2 Query: 110 EVLQSEELPYAPIGSWLQKATVRIIYPDGQTAESTF 3 EV+ SEELPYAP G WL KATVR+ YP G T STF Sbjct: 17 EVISSEELPYAPPGYWLLKATVRVTYPHGPTVVSTF 52