BLASTX nr result
ID: Glycyrrhiza32_contig00029837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029837 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003546383.1 PREDICTED: fasciclin-like arabinogalactan protein... 54 7e-06 XP_004488227.1 PREDICTED: fasciclin-like arabinogalactan protein... 53 1e-05 XP_014501667.1 PREDICTED: fasciclin-like arabinogalactan protein... 53 1e-05 XP_007138874.1 hypothetical protein PHAVU_009G244800g [Phaseolus... 53 1e-05 >XP_003546383.1 PREDICTED: fasciclin-like arabinogalactan protein 4 [Glycine max] KRH12154.1 hypothetical protein GLYMA_15G155400 [Glycine max] Length = 426 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 245 SLSPSGKLVGKLLQTTGRATVNVGAVNITHDPRIGLIS 358 +L PSGKLV LLQTTGRAT N G+VN+T DP+ G+IS Sbjct: 114 ALPPSGKLVTTLLQTTGRATDNFGSVNLTRDPQSGVIS 151 >XP_004488227.1 PREDICTED: fasciclin-like arabinogalactan protein 4 [Cicer arietinum] Length = 398 Score = 53.1 bits (126), Expect = 1e-05 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +2 Query: 245 SLSPSGKLVGKLLQTTGRATVNVGAVNITHDPRIGLIS 358 SL PSGKLV L QTTGRAT N G+VNITHDP +S Sbjct: 114 SLPPSGKLVTTLFQTTGRATNNFGSVNITHDPHTDAVS 151 >XP_014501667.1 PREDICTED: fasciclin-like arabinogalactan protein 4 [Vigna radiata var. radiata] Length = 425 Score = 53.1 bits (126), Expect = 1e-05 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 245 SLSPSGKLVGKLLQTTGRATVNVGAVNITHDPRIGLIS 358 +L P+GKLV LLQTTGRAT N G+VN+T DP+ GL+S Sbjct: 115 ALPPAGKLVTTLLQTTGRATDNFGSVNLTRDPQSGLVS 152 >XP_007138874.1 hypothetical protein PHAVU_009G244800g [Phaseolus vulgaris] ESW10868.1 hypothetical protein PHAVU_009G244800g [Phaseolus vulgaris] Length = 437 Score = 53.1 bits (126), Expect = 1e-05 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 245 SLSPSGKLVGKLLQTTGRATVNVGAVNITHDPRIGLIS 358 +L P+GKLV LLQTTGRAT N G+VN+T DP+ GL+S Sbjct: 126 ALPPAGKLVTTLLQTTGRATDNFGSVNLTRDPQSGLVS 163