BLASTX nr result
ID: Glycyrrhiza32_contig00029552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029552 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507163.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 6e-10 XP_003606718.1 pentatricopeptide (PPR) repeat protein [Medicago ... 54 1e-06 GAU47971.1 hypothetical protein TSUD_87750 [Trifolium subterraneum] 54 2e-06 GAU47972.1 hypothetical protein TSUD_87760 [Trifolium subterraneum] 54 2e-06 >XP_004507163.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Cicer arietinum] Length = 550 Score = 63.5 bits (153), Expect = 6e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +1 Query: 124 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTY 243 MHA+VR+TT ++IPAKNAIL+ HR LRSEPEAYAELI+TY Sbjct: 1 MHALVRTTTSIKIPAKNAILN-HRLLRSEPEAYAELIETY 39 >XP_003606718.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES88915.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 550 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 124 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTY 243 MHA VR+T ++IP KNAI + H FLRSEPE+YA+LI+TY Sbjct: 1 MHAFVRTTQSLKIPTKNAIFNHH-FLRSEPESYAKLIETY 39 >GAU47971.1 hypothetical protein TSUD_87750 [Trifolium subterraneum] Length = 358 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 124 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTY 243 MH ++R TT +RIP KNAI + HRFLRSEPE+YA+LI+ Y Sbjct: 1 MHVLLRITTPLRIPTKNAIFN-HRFLRSEPESYAKLIEIY 39 >GAU47972.1 hypothetical protein TSUD_87760 [Trifolium subterraneum] Length = 550 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 124 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTY 243 MH ++R TT +RIP KNAI + HRFLRSEPE+YA+LI+ Y Sbjct: 1 MHVLLRITTPLRIPTKNAIFN-HRFLRSEPESYAKLIEIY 39