BLASTX nr result
ID: Glycyrrhiza32_contig00029457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029457 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), p... 59 2e-07 XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [M... 57 8e-07 XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), p... 57 8e-07 >XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89895.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1157 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 7/69 (10%) Frame = -1 Query: 376 NIKMSACISQGVHEEVQVMNCGYRWVFKEDLQ-----MLHCENLFAQRREFLAIED*AQ- 215 +I+M I G +V+V NCGYRWV+K DLQ M+HC++ AQ + L IED AQ Sbjct: 1023 DIRMEVLIVDGEGLDVEVKNCGYRWVYKHDLQHLNFTMMHCKSSLAQNCDILGIEDEAQP 1082 Query: 214 -LLIKSDYC 191 LL+ +C Sbjct: 1083 ELLLYESFC 1091 >XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89794.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1054 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = -1 Query: 403 ENERRRGDHNIKMSACISQGVHEEVQVMNCGYRWVFKEDLQ-----MLHCENLFAQRREF 239 +N+ + +I M+AC+ G V V CGYR+VFK+DL+ ++H N FAQ+R+F Sbjct: 990 QNKAFKDVDHITMTACLEDGNGLHVDVKTCGYRYVFKQDLKQFNSTVMHHRNPFAQKRKF 1049 Query: 238 LAIED 224 LAIED Sbjct: 1050 LAIED 1054 >XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89817.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1055 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 376 NIKMSACISQGVHEEVQVMNCGYRWVFKEDLQ---MLHCENLFAQRREFLAIED*AQ 215 +I M A I +G +++V NCGY WV+K DLQ M+H N A++R+FLAIED AQ Sbjct: 998 DINMKASIMKGQGLDLEVQNCGYHWVYKPDLQELTMMHPGNSVARKRKFLAIEDEAQ 1054