BLASTX nr result
ID: Glycyrrhiza32_contig00029361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029361 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN23036.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 76 6e-14 KRH49436.1 hypothetical protein GLYMA_07G154100 [Glycine max] 76 6e-14 XP_003530300.2 PREDICTED: lectin-domain containing receptor kina... 76 6e-14 XP_007134605.1 hypothetical protein PHAVU_010G060800g [Phaseolus... 75 2e-13 KYP46087.1 Lectin-domain containing receptor kinase A4.2 [Cajanu... 74 2e-13 KHN40717.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 74 2e-13 XP_003551569.1 PREDICTED: lectin-domain containing receptor kina... 74 2e-13 XP_007140223.1 hypothetical protein PHAVU_008G094500g [Phaseolus... 74 3e-13 KYP37366.1 Lectin-domain containing receptor kinase A4.3 [Cajanu... 73 7e-13 KHN28870.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 72 1e-12 XP_003522051.1 PREDICTED: probable L-type lectin-domain containi... 72 1e-12 XP_014511779.1 PREDICTED: lectin-domain containing receptor kina... 69 1e-11 XP_017441764.1 PREDICTED: lectin-domain containing receptor kina... 69 2e-11 KOM37444.1 hypothetical protein LR48_Vigan03g082600 [Vigna angul... 69 2e-11 XP_014490660.1 PREDICTED: lectin-domain containing receptor kina... 69 2e-11 XP_017416504.1 PREDICTED: lectin-domain containing receptor kina... 69 2e-11 GAV73593.1 Pkinase domain-containing protein/Lectin_legB domain-... 65 3e-10 XP_019429697.1 PREDICTED: probable L-type lectin-domain containi... 65 3e-10 XP_019076992.1 PREDICTED: lectin-domain containing receptor kina... 56 5e-07 XP_010653406.1 PREDICTED: lectin-domain containing receptor kina... 56 5e-07 >KHN23036.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 625 Score = 75.9 bits (185), Expect = 6e-14 Identities = 35/41 (85%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 538 LVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 578 >KRH49436.1 hypothetical protein GLYMA_07G154100 [Glycine max] Length = 681 Score = 75.9 bits (185), Expect = 6e-14 Identities = 35/41 (85%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 594 LVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 634 >XP_003530300.2 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Glycine max] Length = 696 Score = 75.9 bits (185), Expect = 6e-14 Identities = 35/41 (85%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 609 LVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 649 >XP_007134605.1 hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] ESW06599.1 hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] Length = 662 Score = 74.7 bits (182), Expect = 2e-13 Identities = 33/43 (76%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYD 181 LVLKLGLLCTQ+KA+YRP+++QVTRYLNFDDP P + DWR+YD Sbjct: 587 LVLKLGLLCTQNKAEYRPSIEQVTRYLNFDDPFPDISDWRYYD 629 >KYP46087.1 Lectin-domain containing receptor kinase A4.2 [Cajanus cajan] Length = 499 Score = 74.3 bits (181), Expect = 2e-13 Identities = 39/58 (67%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLCTQ KAD+RP+MKQ+TRYLNFDDPLP +WRH D FLEAM Sbjct: 418 LVLKLGLLCTQHKADHRPSMKQLTRYLNFDDPLPHTSEWRHCD-SQSSTTSFGFLEAM 474 >KHN40717.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 683 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLCTQ +ADYRP+MKQVTRYLNFDDPLP + DW H Sbjct: 601 LVLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGH 641 >XP_003551569.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Glycine max] KRH00306.1 hypothetical protein GLYMA_18G205000 [Glycine max] Length = 683 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLCTQ +ADYRP+MKQVTRYLNFDDPLP + DW H Sbjct: 601 LVLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGH 641 >XP_007140223.1 hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] ESW12217.1 hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] Length = 673 Score = 73.9 bits (180), Expect = 3e-13 Identities = 36/56 (64%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLE 142 LVLKLGLLC+Q + DYRPTMKQVTRYLNFDDPLP DW H+ FLE Sbjct: 590 LVLKLGLLCSQHRPDYRPTMKQVTRYLNFDDPLPDTADWGHFGSNSSSRMNSGFLE 645 >KYP37366.1 Lectin-domain containing receptor kinase A4.3 [Cajanus cajan] Length = 505 Score = 72.8 bits (177), Expect = 7e-13 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DW 193 LVLKLGLLCTQ +ADYRPTMKQVTRYLNFDDPLP + DW Sbjct: 422 LVLKLGLLCTQHRADYRPTMKQVTRYLNFDDPLPEIGDW 460 >KHN28870.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 677 Score = 72.4 bits (176), Expect = 1e-12 Identities = 39/58 (67%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLC+Q KA+YRP+MKQV RYLNFDD LP + DWR+YD SFLEAM Sbjct: 595 LVLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYD-SQSSTNSLSFLEAM 651 >XP_003522051.1 PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1 [Glycine max] KRH65635.1 hypothetical protein GLYMA_03G051100 [Glycine max] Length = 677 Score = 72.4 bits (176), Expect = 1e-12 Identities = 39/58 (67%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLC+Q KA+YRP+MKQV RYLNFDD LP + DWR+YD SFLEAM Sbjct: 595 LVLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYD-SQSSTNSLSFLEAM 651 >XP_014511779.1 PREDICTED: lectin-domain containing receptor kinase VI.4-like [Vigna radiata var. radiata] Length = 668 Score = 69.3 bits (168), Expect = 1e-11 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLC+Q+KA+YRP+++QVTRYLNFDDP P + D R+YD FLEAM Sbjct: 587 LVLKLGLLCSQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYD-SQSSTTSLGFLEAM 643 >XP_017441764.1 PREDICTED: lectin-domain containing receptor kinase VI.4-like [Vigna angularis] KOM58011.1 hypothetical protein LR48_Vigan11g104400 [Vigna angularis] BAT97457.1 hypothetical protein VIGAN_09090500 [Vigna angularis var. angularis] Length = 667 Score = 68.9 bits (167), Expect = 2e-11 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLC Q+KA+YRP+++QVTRYLNFDDP P + D R+YD FLEAM Sbjct: 586 LVLKLGLLCAQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYD-SQSSTTSLGFLEAM 642 >KOM37444.1 hypothetical protein LR48_Vigan03g082600 [Vigna angularis] BAT84050.1 hypothetical protein VIGAN_04131800 [Vigna angularis var. angularis] Length = 677 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 LVLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 594 LVLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 627 >XP_014490660.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Vigna radiata var. radiata] Length = 683 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 LVLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 598 LVLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 631 >XP_017416504.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Vigna angularis] Length = 697 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 LVLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 614 LVLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 647 >GAV73593.1 Pkinase domain-containing protein/Lectin_legB domain-containing protein [Cephalotus follicularis] Length = 674 Score = 65.5 bits (158), Expect = 3e-10 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVVD-WRHYDXXXXXXXXXSFLEAM 136 LVLKLGLLC+ K + RPTM+QV RYLN DDPLPVVD W +D FLE + Sbjct: 592 LVLKLGLLCSHQKPEVRPTMRQVVRYLNGDDPLPVVDNWSSFDSSQSSEMRSRFLEVI 649 >XP_019429697.1 PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1 [Lupinus angustifolius] OIW19144.1 hypothetical protein TanjilG_10325 [Lupinus angustifolius] Length = 683 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 LVLKLGLLC +ADYRPTMK+VTRYLNFD+ LP + DW H Sbjct: 602 LVLKLGLLCCHHRADYRPTMKEVTRYLNFDELLPSIADWTH 642 >XP_019076992.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like isoform X2 [Vitis vinifera] Length = 713 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DWRHYDXXXXXXXXXSFLE 142 LVL+LGL C+ + + RPTM+QVTRYL+ DDPLP+V DW D FL+ Sbjct: 630 LVLRLGLFCSHPRPEARPTMRQVTRYLSRDDPLPIVDDWAAPDSSRFSDISPRFLQ 685 >XP_010653406.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like isoform X1 [Vitis vinifera] Length = 723 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -2 Query: 306 LVLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DWRHYDXXXXXXXXXSFLE 142 LVL+LGL C+ + + RPTM+QVTRYL+ DDPLP+V DW D FL+ Sbjct: 640 LVLRLGLFCSHPRPEARPTMRQVTRYLSRDDPLPIVDDWAAPDSSRFSDISPRFLQ 695