BLASTX nr result
ID: Glycyrrhiza32_contig00029358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029358 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_050465989.1 EAL domain-containing protein [Pseudomonas aerugi... 107 9e-27 KJS29200.1 hypothetical protein VR76_06445 [Pseudomonas sp. BRH_... 107 9e-27 WP_034022897.1 EAL domain-containing protein [Pseudomonas aerugi... 107 9e-27 WP_009684325.1 MULTISPECIES: EAL domain-containing protein [Pseu... 107 9e-27 WP_023100652.1 EAL domain-containing protein [Pseudomonas aerugi... 106 2e-26 WP_033962380.1 EAL domain-containing protein [Pseudomonas aerugi... 105 3e-26 WP_070610825.1 hypothetical protein [Pseudomonas sp. HMSC064G05]... 104 1e-25 KJS79109.1 hypothetical protein JL55_13950 [Pseudomonas sp. BICA... 101 1e-24 WP_051723212.1 EAL domain-containing protein [Cupriavidus metall... 81 1e-16 WP_009684326.1 MULTISPECIES: hypothetical protein [Pseudomonas] ... 65 4e-11 WP_015026494.1 hypothetical protein [Pseudomonas putida] AFK7302... 64 4e-11 WP_033962383.1 hypothetical protein [Pseudomonas aeruginosa] KJS... 63 3e-10 WP_023100651.1 hypothetical protein [Pseudomonas aeruginosa] ERV... 63 3e-10 WP_070610827.1 hypothetical protein [Pseudomonas sp. HMSC064G05]... 62 5e-10 WP_034022899.1 hypothetical protein [Pseudomonas aeruginosa] 62 5e-10 WP_050465988.1 hypothetical protein [Pseudomonas aeruginosa] CRP... 62 6e-10 KJS79110.1 hypothetical protein JL55_13955 [Pseudomonas sp. BICA... 60 2e-09 >WP_050465989.1 EAL domain-containing protein [Pseudomonas aeruginosa] CRP50736.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] CRP78419.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] Length = 237 Score = 107 bits (266), Expect = 9e-27 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 53 >KJS29200.1 hypothetical protein VR76_06445 [Pseudomonas sp. BRH_c35] Length = 237 Score = 107 bits (266), Expect = 9e-27 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 53 >WP_034022897.1 EAL domain-containing protein [Pseudomonas aeruginosa] Length = 237 Score = 107 bits (266), Expect = 9e-27 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 53 >WP_009684325.1 MULTISPECIES: EAL domain-containing protein [Pseudomonas] EGB97799.1 hypothetical protein G1E_16623 [Pseudomonas sp. TJI-51] AFK73020.1 hypothetical protein YSA_p00123 (plasmid) [Pseudomonas putida ND6] ERW38889.1 hypothetical protein Q031_05917 [Pseudomonas aeruginosa BWHPSA018] CRN68064.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] CRO05225.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] KSD99888.1 hypothetical protein AO912_14680 [Pseudomonas aeruginosa] KSL28828.1 hypothetical protein APA43_22565 [Pseudomonas aeruginosa] OCT33310.1 hypothetical protein A6E23_24170 [Pseudomonas putida] OCT34334.1 hypothetical protein A6E20_22650 [Pseudomonas putida] OCT35150.1 hypothetical protein A6E24_24150 [Pseudomonas putida] OCT41426.1 hypothetical protein A6E19_24255 [Pseudomonas putida] OFQ31390.1 hypothetical protein HMPREF2947_00360 [Pseudomonas sp. HMSC069G05] OKS46934.1 hypothetical protein BH609_00250 [Pseudomonas aeruginosa] Length = 237 Score = 107 bits (266), Expect = 9e-27 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 53 >WP_023100652.1 EAL domain-containing protein [Pseudomonas aeruginosa] ERV24038.1 hypothetical protein Q068_06318 [Pseudomonas aeruginosa BL14] ERV69378.1 hypothetical protein Q041_06916 [Pseudomonas aeruginosa BWHPSA028] ETU71937.1 hypothetical protein Q094_06947 [Pseudomonas aeruginosa PS42] AKG03036.1 hypothetical protein YH69_33830 (plasmid) [Pseudomonas aeruginosa] CRP65280.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] KSD76332.1 hypothetical protein AO910_11985 [Pseudomonas aeruginosa] KSG28454.1 hypothetical protein AO946_16320 [Pseudomonas aeruginosa] KSG54703.1 hypothetical protein AO953_15375 [Pseudomonas aeruginosa] KSQ08290.1 hypothetical protein APB25_15855 [Pseudomonas aeruginosa] KSQ21237.1 hypothetical protein APB28_12190 [Pseudomonas aeruginosa] KSQ35918.1 hypothetical protein APB34_10310 [Pseudomonas aeruginosa] KSS90906.1 hypothetical protein APB72_15160 [Pseudomonas aeruginosa] KWR92549.1 hypothetical protein AVM47_32275 [Pseudomonas aeruginosa] KYO74872.1 Cyclic di-GMP phosphodiesterase YfgF [Pseudomonas aeruginosa] OFC00109.1 hypothetical protein AN472_27585 [Pseudomonas aeruginosa] OFC31345.1 hypothetical protein AN464_27335 [Pseudomonas aeruginosa] OKR83735.1 hypothetical protein BH600_15790 [Pseudomonas aeruginosa] Length = 237 Score = 106 bits (264), Expect = 2e-26 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQ+GEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQMGEEFGFIDLID 53 >WP_033962380.1 EAL domain-containing protein [Pseudomonas aeruginosa] Length = 237 Score = 105 bits (263), Expect = 3e-26 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPI+DARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIMDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 53 >WP_070610825.1 hypothetical protein [Pseudomonas sp. HMSC064G05] OFL95831.1 hypothetical protein HMPREF2725_01355 [Pseudomonas sp. HMSC064G05] Length = 237 Score = 104 bits (259), Expect = 1e-25 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIVDARTGAVSHYEALARTRG RSGHVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVDARTGAVSHYEALARTRGGRSGHVKLLQLGEEFGFIDLID 53 >KJS79109.1 hypothetical protein JL55_13950 [Pseudomonas sp. BICA1-14] Length = 237 Score = 101 bits (252), Expect = 1e-24 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVVSPVFQPIV+ARTGAVSHYEALART+GVRS HVKLLQLGEEFGFIDLID Sbjct: 1 MRKVVSPVFQPIVNARTGAVSHYEALARTKGVRSNHVKLLQLGEEFGFIDLID 53 >WP_051723212.1 EAL domain-containing protein [Cupriavidus metallidurans] Length = 239 Score = 80.9 bits (198), Expect = 1e-16 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 123 MRKVVSPVFQPIVDARTGAVSHYEALARTRGVRSGHVKLLQLGEEFGFIDLID 281 MRKVV+PVF PIV+ TG VSHYEALAR R GHVKL+++GEE+GF+DLID Sbjct: 1 MRKVVAPVFMPIVEVSTGRVSHYEALARVREGNGGHVKLIEVGEEYGFVDLID 53 >WP_009684326.1 MULTISPECIES: hypothetical protein [Pseudomonas] EGB97800.1 hypothetical protein G1E_16628 [Pseudomonas sp. TJI-51] ERW38890.1 hypothetical protein Q031_05918 [Pseudomonas aeruginosa BWHPSA018] CRN68092.1 hypothetical protein PAERUG_P39_London_29_08_12_01108 [Pseudomonas aeruginosa] CRO05271.1 hypothetical protein PAERUG_P1_London_28_IMP_1_04_05_00909 [Pseudomonas aeruginosa] KSD99887.1 hypothetical protein AO912_14675 [Pseudomonas aeruginosa] KSL28827.1 hypothetical protein APA43_22560 [Pseudomonas aeruginosa] OCT33309.1 hypothetical protein A6E23_24165 [Pseudomonas putida] OCT34333.1 hypothetical protein A6E20_22645 [Pseudomonas putida] OCT35149.1 hypothetical protein A6E24_24145 [Pseudomonas putida] OCT41425.1 hypothetical protein A6E19_24250 [Pseudomonas putida] OFQ31391.1 hypothetical protein HMPREF2947_00365 [Pseudomonas sp. HMSC069G05] OKS46935.1 hypothetical protein BH609_00255 [Pseudomonas aeruginosa] Length = 171 Score = 65.1 bits (157), Expect = 4e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 RVYAKRALWVHLNSIEAITDAPINWASKEL Sbjct: 142 RVYAKRALWVHLNSIEAITDAPINWASKEL 171 >WP_015026494.1 hypothetical protein [Pseudomonas putida] AFK73021.1 hypothetical protein YSA_p00125 (plasmid) [Pseudomonas putida ND6] Length = 122 Score = 63.9 bits (154), Expect = 4e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 RVYAKRALWVHLNSIEAITDAPINWASK+L Sbjct: 93 RVYAKRALWVHLNSIEAITDAPINWASKDL 122 >WP_033962383.1 hypothetical protein [Pseudomonas aeruginosa] KJS29199.1 hypothetical protein VR76_06440 [Pseudomonas sp. BRH_c35] Length = 171 Score = 62.8 bits (151), Expect = 3e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 RVYAKRA+WVHLNSIEAITDAPINWASK+L Sbjct: 142 RVYAKRAVWVHLNSIEAITDAPINWASKDL 171 >WP_023100651.1 hypothetical protein [Pseudomonas aeruginosa] ERV24037.1 hypothetical protein Q068_06317 [Pseudomonas aeruginosa BL14] ERV69379.1 hypothetical protein Q041_06917 [Pseudomonas aeruginosa BWHPSA028] ETU71936.1 hypothetical protein Q094_06946 [Pseudomonas aeruginosa PS42] AKG03037.1 hypothetical protein YH69_33835 (plasmid) [Pseudomonas aeruginosa] CRP65263.1 hypothetical protein PAERUG_P19_London_7_VIM_2_05_10_05134 [Pseudomonas aeruginosa] KSD76331.1 hypothetical protein AO910_11980 [Pseudomonas aeruginosa] KSG28453.1 hypothetical protein AO946_16315 [Pseudomonas aeruginosa] KSG54702.1 hypothetical protein AO953_15370 [Pseudomonas aeruginosa] KSQ08291.1 hypothetical protein APB25_15860 [Pseudomonas aeruginosa] KSQ21236.1 hypothetical protein APB28_12185 [Pseudomonas aeruginosa] KSQ35919.1 hypothetical protein APB34_10315 [Pseudomonas aeruginosa] KSS90907.1 hypothetical protein APB72_15165 [Pseudomonas aeruginosa] KWR92550.1 hypothetical protein AVM47_32280 [Pseudomonas aeruginosa] KYO74873.1 hypothetical protein LT18_06437 [Pseudomonas aeruginosa] OFC00110.1 hypothetical protein AN472_27590 [Pseudomonas aeruginosa] OFC31346.1 hypothetical protein AN464_27340 [Pseudomonas aeruginosa] OKR83734.1 hypothetical protein BH600_15785 [Pseudomonas aeruginosa] Length = 171 Score = 62.8 bits (151), Expect = 3e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 RVYAKRA+WVHLNSIEAITDAPINWASK+L Sbjct: 142 RVYAKRAVWVHLNSIEAITDAPINWASKDL 171 >WP_070610827.1 hypothetical protein [Pseudomonas sp. HMSC064G05] OFL95832.1 hypothetical protein HMPREF2725_01360 [Pseudomonas sp. HMSC064G05] Length = 171 Score = 62.4 bits (150), Expect = 5e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 R YAKRALWVHLNSIEAITDAPINWASK+L Sbjct: 142 RAYAKRALWVHLNSIEAITDAPINWASKDL 171 >WP_034022899.1 hypothetical protein [Pseudomonas aeruginosa] Length = 171 Score = 62.4 bits (150), Expect = 5e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 R+YAKRA+WVHLNSIEAITDAPINWASK+L Sbjct: 142 RIYAKRAVWVHLNSIEAITDAPINWASKDL 171 >WP_050465988.1 hypothetical protein [Pseudomonas aeruginosa] CRP50724.1 hypothetical protein PAERUG_P26_Wales_1_VIM_2_11_10_05478 [Pseudomonas aeruginosa] CRP78397.1 hypothetical protein PAERUG_P27_Wales_1_VIM_2_02_11_05354 [Pseudomonas aeruginosa] Length = 171 Score = 62.0 bits (149), Expect = 6e-10 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 R+YAKRA+WVHLNS+EAITDAPINWASK+L Sbjct: 142 RIYAKRAVWVHLNSVEAITDAPINWASKDL 171 >KJS79110.1 hypothetical protein JL55_13955 [Pseudomonas sp. BICA1-14] Length = 171 Score = 60.5 bits (145), Expect = 2e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 RVYAKRALWVHLNSIEAITDAPINWASKEL 92 RVYAKRA+WVHLN+IEAITDAPINWA+K+L Sbjct: 142 RVYAKRAVWVHLNAIEAITDAPINWATKDL 171