BLASTX nr result
ID: Glycyrrhiza32_contig00029352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029352 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003625942.1 hypothetical protein MTR_7g109230 [Medicago trunc... 52 4e-06 >XP_003625942.1 hypothetical protein MTR_7g109230 [Medicago truncatula] AES82160.1 hypothetical protein MTR_7g109230 [Medicago truncatula] Length = 169 Score = 52.4 bits (124), Expect = 4e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 14/60 (23%) Frame = -2 Query: 158 SYFPPGTPFTYYVPPDYDSSGGGKMM----PLLFSN----------QCLISATFFYLPLI 21 SYFPPGTPF YYVPPDY + G+ + + FSN QCLI+ F LP + Sbjct: 110 SYFPPGTPFPYYVPPDYYNKNSGETLVPFQAIFFSNPNSHFVYSIIQCLINLLFLCLPYV 169