BLASTX nr result
ID: Glycyrrhiza32_contig00029290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029290 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007136565.1 hypothetical protein PHAVU_009G055600g [Phaseolus... 54 3e-06 >XP_007136565.1 hypothetical protein PHAVU_009G055600g [Phaseolus vulgaris] ESW08559.1 hypothetical protein PHAVU_009G055600g [Phaseolus vulgaris] Length = 366 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +3 Query: 144 PCLSSPSNAAYAAPTNTITHRFKEAPEFYNPPNCASIADT 263 P SS SN A + T TITH+FKEAPEFYN P+CASI DT Sbjct: 27 PSPSSSSNEAKST-TTTITHQFKEAPEFYNSPDCASITDT 65