BLASTX nr result
ID: Glycyrrhiza32_contig00029260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029260 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU18609.1 hypothetical protein TSUD_124400 [Trifolium subterran... 62 4e-10 XP_003600563.1 RNA-binding KH domain protein [Medicago truncatul... 63 6e-10 XP_019424679.1 PREDICTED: KH domain-containing protein At3g08620... 62 9e-10 XP_019424676.1 PREDICTED: KH domain-containing protein At3g08620... 62 1e-09 KRH30683.1 hypothetical protein GLYMA_11G200400 [Glycine max] 61 2e-09 XP_006591271.1 PREDICTED: KH domain-containing protein At3g08620... 61 2e-09 XP_019439579.1 PREDICTED: KH domain-containing protein At2g38610... 62 2e-09 KHN24715.1 KH domain-containing protein [Glycine soja] 61 3e-09 XP_003538342.1 PREDICTED: KH domain-containing protein At3g08620... 61 3e-09 XP_019424677.1 PREDICTED: KH domain-containing protein At3g08620... 61 4e-09 XP_017434062.1 PREDICTED: KH domain-containing protein SPIN1-lik... 60 6e-09 XP_007146910.1 hypothetical protein PHAVU_006G080900g [Phaseolus... 60 7e-09 KRG98099.1 hypothetical protein GLYMA_18G050300 [Glycine max] 59 8e-09 XP_017434060.1 PREDICTED: KH domain-containing protein SPIN1-lik... 60 9e-09 XP_014626702.1 PREDICTED: KH domain-containing protein SPIN1-lik... 59 1e-08 KYP44033.1 KH domain-containing protein At2g38610 family [Cajanu... 60 1e-08 KRG98098.1 hypothetical protein GLYMA_18G050300 [Glycine max] 59 1e-08 KHN18643.1 KH domain-containing protein [Glycine soja] 59 2e-08 XP_004500397.1 PREDICTED: KH domain-containing protein SPIN1-lik... 59 2e-08 XP_003553178.1 PREDICTED: KH domain-containing protein At3g08620... 59 2e-08 >GAU18609.1 hypothetical protein TSUD_124400 [Trifolium subterraneum] Length = 179 Score = 62.4 bits (150), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 260 DVQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +V+GLNMD Q P+V SSH+VKKILRLDIPKD YPNF Sbjct: 8 EVKGLNMDLQTLPVVPSSHIVKKILRLDIPKDGYPNF 44 >XP_003600563.1 RNA-binding KH domain protein [Medicago truncatula] AES70814.1 RNA-binding KH domain protein [Medicago truncatula] Length = 237 Score = 62.8 bits (151), Expect = 6e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 260 DVQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +V+GLNMD Q AP+V +SH+VKKILRLDIPKD YPNF Sbjct: 111 EVKGLNMDWQTAPVVPNSHIVKKILRLDIPKDGYPNF 147 >XP_019424679.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X4 [Lupinus angustifolius] Length = 236 Score = 62.4 bits (150), Expect = 9e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLN+D Q AP+V +SH+VKKILRLDIPKDSYPNF Sbjct: 65 LQGLNVDWQAAPVVPNSHIVKKILRLDIPKDSYPNF 100 >XP_019424676.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X1 [Lupinus angustifolius] OIV91969.1 hypothetical protein TanjilG_26491 [Lupinus angustifolius] Length = 283 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLN+D Q AP+V +SH+VKKILRLDIPKDSYPNF Sbjct: 112 LQGLNVDWQAAPVVPNSHIVKKILRLDIPKDSYPNF 147 >KRH30683.1 hypothetical protein GLYMA_11G200400 [Glycine max] Length = 201 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 32 VQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 67 >XP_006591271.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X3 [Glycine max] KRH30682.1 hypothetical protein GLYMA_11G200400 [Glycine max] Length = 236 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 67 VQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 102 >XP_019439579.1 PREDICTED: KH domain-containing protein At2g38610-like [Lupinus angustifolius] XP_019439580.1 PREDICTED: KH domain-containing protein At2g38610-like [Lupinus angustifolius] OIW14105.1 hypothetical protein TanjilG_19484 [Lupinus angustifolius] Length = 283 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLN D Q AP+V +SH+VKKILRLDIPKDSYPNF Sbjct: 112 LQGLNSDWQTAPVVPNSHIVKKILRLDIPKDSYPNF 147 >KHN24715.1 KH domain-containing protein [Glycine soja] Length = 283 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 114 VQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 149 >XP_003538342.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X1 [Glycine max] KRH30680.1 hypothetical protein GLYMA_11G200400 [Glycine max] Length = 283 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 114 VQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 149 >XP_019424677.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X2 [Lupinus angustifolius] Length = 277 Score = 60.8 bits (146), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 254 QGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +GLN+D Q AP+V +SH+VKKILRLDIPKDSYPNF Sbjct: 107 EGLNVDWQAAPVVPNSHIVKKILRLDIPKDSYPNF 141 >XP_017434062.1 PREDICTED: KH domain-containing protein SPIN1-like isoform X2 [Vigna angularis] Length = 236 Score = 60.1 bits (144), Expect = 6e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 67 MQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 102 >XP_007146910.1 hypothetical protein PHAVU_006G080900g [Phaseolus vulgaris] ESW18904.1 hypothetical protein PHAVU_006G080900g [Phaseolus vulgaris] Length = 244 Score = 60.1 bits (144), Expect = 7e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 75 MQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 110 >KRG98099.1 hypothetical protein GLYMA_18G050300 [Glycine max] Length = 201 Score = 59.3 bits (142), Expect = 8e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGL+MD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 32 VQGLSMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 67 >XP_017434060.1 PREDICTED: KH domain-containing protein SPIN1-like isoform X1 [Vigna angularis] XP_017434061.1 PREDICTED: KH domain-containing protein SPIN1-like isoform X1 [Vigna angularis] KOM52738.1 hypothetical protein LR48_Vigan09g139700 [Vigna angularis] BAT88207.1 hypothetical protein VIGAN_05165400 [Vigna angularis var. angularis] Length = 280 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 +QGLNMD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 111 MQGLNMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 146 >XP_014626702.1 PREDICTED: KH domain-containing protein SPIN1-like isoform X2 [Glycine max] Length = 236 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGL+MD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 67 VQGLSMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 102 >KYP44033.1 KH domain-containing protein At2g38610 family [Cajanus cajan] Length = 283 Score = 59.7 bits (143), Expect = 1e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGLNMD Q +P+ SS +VKKILRLDIPKDSYPNF Sbjct: 114 VQGLNMDWQTSPVAPSSPIVKKILRLDIPKDSYPNF 149 >KRG98098.1 hypothetical protein GLYMA_18G050300 [Glycine max] Length = 245 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGL+MD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 76 VQGLSMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 111 >KHN18643.1 KH domain-containing protein [Glycine soja] Length = 283 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGL+MD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 114 VQGLSMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 149 >XP_004500397.1 PREDICTED: KH domain-containing protein SPIN1-like [Cicer arietinum] Length = 283 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 260 DVQGLNMDRQIAP-IVASSHMVKKILRLDIPKDSYPNF 150 +V+GLNMD Q AP +V SSH+VKKILRLDIPKD YPNF Sbjct: 112 EVKGLNMDWQTAPSVVPSSHIVKKILRLDIPKDGYPNF 149 >XP_003553178.1 PREDICTED: KH domain-containing protein At3g08620-like isoform X1 [Glycine max] KRG98097.1 hypothetical protein GLYMA_18G050300 [Glycine max] Length = 283 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 257 VQGLNMDRQIAPIVASSHMVKKILRLDIPKDSYPNF 150 VQGL+MD Q +P+V SS +VKKILRLDIPKDSYPNF Sbjct: 114 VQGLSMDWQTSPVVPSSPIVKKILRLDIPKDSYPNF 149