BLASTX nr result
ID: Glycyrrhiza32_contig00029142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029142 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004510941.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 75 1e-17 GAU25151.1 hypothetical protein TSUD_363210 [Trifolium subterran... 76 2e-17 XP_013445013.1 brefeldin A-inhibited guanine nucleotide-exchange... 74 3e-17 OIW18996.1 hypothetical protein TanjilG_20269 [Lupinus angustifo... 74 4e-17 XP_019447286.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 4e-17 XP_008375824.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 4e-17 XP_008343168.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 6e-17 XP_009347045.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 8e-17 XP_009379267.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 8e-17 XP_008232679.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 72 2e-16 XP_007220577.1 hypothetical protein PRUPE_ppa000110mg [Prunus pe... 72 2e-16 XP_019463522.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 71 2e-16 OIW00805.1 hypothetical protein TanjilG_18607 [Lupinus angustifo... 71 2e-16 KRH76286.1 hypothetical protein GLYMA_01G144200 [Glycine max] KR... 74 5e-16 XP_003534607.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 70 5e-16 XP_014630702.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 5e-16 XP_003521643.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 74 5e-16 XP_016198049.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 70 7e-16 XP_004492642.1 PREDICTED: brefeldin A-inhibited guanine nucleoti... 70 7e-16 XP_015961466.1 PREDICTED: LOW QUALITY PROTEIN: brefeldin A-inhib... 70 7e-16 >XP_004510941.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Cicer arietinum] Length = 1786 Score = 75.5 bits (184), Expect(2) = 1e-17 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++A+ YLR E D G TAGE KLLS++IESVC+CHD GD+ MEL+VLKT L A S Sbjct: 107 QKLIAYGYLRGEVDPGGTAGEAKLLSNVIESVCKCHDFGDETMELMVLKTLLSAVTS 163 Score = 41.2 bits (95), Expect(2) = 1e-17 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 166 LRIHGDCLLLIVRTCYDIYL 185 >GAU25151.1 hypothetical protein TSUD_363210 [Trifolium subterraneum] Length = 1809 Score = 75.9 bits (185), Expect(2) = 2e-17 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD T+GE KLLS++IESVC+CHD GD+ MELLVLKT L A S Sbjct: 107 QKLIAHGYLRGEADPCGTSGEAKLLSNMIESVCKCHDFGDEGMELLVLKTLLSAVTS 163 Score = 40.4 bits (93), Expect(2) = 2e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 166 LRIHGDCLLQIVRTCYDIYL 185 >XP_013445013.1 brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] KEH19038.1 brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] Length = 1784 Score = 74.3 bits (181), Expect(2) = 3e-17 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH +LR EAD G ++ E KLLS +IESVC+CHD GD AMELLVLKT L A S Sbjct: 111 QKLIAHGFLRGEADPGGSSSEAKLLSKMIESVCKCHDFGDDAMELLVLKTLLSAVTS 167 Score = 41.2 bits (95), Expect(2) = 3e-17 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 170 LRIHGDCLLLIVRTCYDIYL 189 >OIW18996.1 hypothetical protein TanjilG_20269 [Lupinus angustifolius] Length = 1830 Score = 73.9 bits (180), Expect(2) = 4e-17 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD +A E KLLS+LIESVC+CHD GD AMELL+LKT L A S Sbjct: 107 QKLIAHGYLRGEADPTGSAAEAKLLSNLIESVCKCHDFGDDAMELLLLKTLLSAVTS 163 Score = 41.2 bits (95), Expect(2) = 4e-17 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 166 LRIHGDCLLLIVRTCYDIYL 185 >XP_019447286.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Lupinus angustifolius] Length = 1779 Score = 73.9 bits (180), Expect(2) = 4e-17 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD +A E KLLS+LIESVC+CHD GD AMELL+LKT L A S Sbjct: 107 QKLIAHGYLRGEADPTGSAAEAKLLSNLIESVCKCHDFGDDAMELLLLKTLLSAVTS 163 Score = 41.2 bits (95), Expect(2) = 4e-17 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 166 LRIHGDCLLLIVRTCYDIYL 185 >XP_008375824.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Malus domestica] Length = 962 Score = 73.9 bits (180), Expect(2) = 4e-17 Identities = 38/60 (63%), Positives = 42/60 (70%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDSRRL 41 Q ++AH YLR EAD A E KLL+ LIESVC+CHDLGD MELLVLKT L A S L Sbjct: 103 QKLIAHGYLRGEADASGGAAEAKLLTRLIESVCKCHDLGDDQMELLVLKTLLSAVTSMSL 162 Score = 41.2 bits (95), Expect(2) = 4e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 162 LRIHGDCLLQMVRTCYDIYL 181 >XP_008343168.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Malus domestica] Length = 1775 Score = 73.9 bits (180), Expect(2) = 6e-17 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD A E KLL+ LIESVC+CHDLGD MELLVLKT L A S Sbjct: 103 QKLIAHGYLRGEADASGDAAEAKLLTKLIESVCKCHDLGDDQMELLVLKTLLSAVTS 159 Score = 40.4 bits (93), Expect(2) = 6e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 162 LRIHGDCLLQIVRTCYDIYL 181 >XP_009347045.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Pyrus x bretschneideri] Length = 1773 Score = 73.6 bits (179), Expect(2) = 8e-17 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD A E KLL+ LIESVC+CHDLGD MELLVLKT L A S Sbjct: 103 QKLIAHGYLRGEADASGGAAEAKLLTKLIESVCKCHDLGDDQMELLVLKTLLSAVTS 159 Score = 40.4 bits (93), Expect(2) = 8e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 162 LRIHGDCLLQIVRTCYDIYL 181 >XP_009379267.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Pyrus x bretschneideri] Length = 1773 Score = 73.6 bits (179), Expect(2) = 8e-17 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD A E KLL+ LIESVC+CHDLGD MELLVLKT L A S Sbjct: 103 QKLIAHGYLRGEADASGGAAEAKLLTKLIESVCKCHDLGDDQMELLVLKTLLSAVTS 159 Score = 40.4 bits (93), Expect(2) = 8e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 162 LRIHGDCLLQIVRTCYDIYL 181 >XP_008232679.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Prunus mume] Length = 1775 Score = 72.0 bits (175), Expect(2) = 2e-16 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD E KLL+ LIESVC+CHDLGD MELLVLKT L A S Sbjct: 106 QKLIAHGYLRGEADASGGGAEAKLLTKLIESVCKCHDLGDDQMELLVLKTLLSAVTS 162 Score = 40.4 bits (93), Expect(2) = 2e-16 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 165 LRIHGDCLLQIVRTCYDIYL 184 >XP_007220577.1 hypothetical protein PRUPE_ppa000110mg [Prunus persica] ONI22719.1 hypothetical protein PRUPE_2G146800 [Prunus persica] Length = 1775 Score = 72.0 bits (175), Expect(2) = 2e-16 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD E KLL+ LIESVC+CHDLGD MELLVLKT L A S Sbjct: 106 QKLIAHGYLRGEADASGGGAEAKLLTKLIESVCKCHDLGDDQMELLVLKTLLSAVTS 162 Score = 40.4 bits (93), Expect(2) = 2e-16 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL VRTCY+IYL Sbjct: 165 LRIHGDCLLQIVRTCYDIYL 184 >XP_019463522.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Lupinus angustifolius] Length = 1767 Score = 71.2 bits (173), Expect(2) = 2e-16 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD A E KLLS+LIESVC+CHD GD A ELL+LKT L A S Sbjct: 107 QRLIAHGYLRGEADHSGGAAEAKLLSNLIESVCKCHDFGDDATELLLLKTLLSAVTS 163 Score = 41.2 bits (95), Expect(2) = 2e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 166 LRIHGDCLLLIVRTCYDIYL 185 >OIW00805.1 hypothetical protein TanjilG_18607 [Lupinus angustifolius] Length = 1710 Score = 71.2 bits (173), Expect(2) = 2e-16 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD A E KLLS+LIESVC+CHD GD A ELL+LKT L A S Sbjct: 107 QRLIAHGYLRGEADHSGGAAEAKLLSNLIESVCKCHDFGDDATELLLLKTLLSAVTS 163 Score = 41.2 bits (95), Expect(2) = 2e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 166 LRIHGDCLLLIVRTCYDIYL 185 >KRH76286.1 hypothetical protein GLYMA_01G144200 [Glycine max] KRH76287.1 hypothetical protein GLYMA_01G144200 [Glycine max] Length = 1808 Score = 73.9 bits (180), Expect(2) = 5e-16 Identities = 40/59 (67%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 220 QGIVAHEYLRDEAD--LGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD G+ A E KLLSSLIESVC+CHD GD AMELLVLKT L A S Sbjct: 108 QKLIAHGYLRGEADPDSGAAAPEAKLLSSLIESVCKCHDFGDDAMELLVLKTLLSAVTS 166 Score = 37.4 bits (85), Expect(2) = 5e-16 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGD LL+ VRTCY+IYL Sbjct: 169 LRIHGDSLLLIVRTCYDIYL 188 >XP_003534607.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Glycine max] KRH40586.1 hypothetical protein GLYMA_09G268400 [Glycine max] Length = 1784 Score = 70.1 bits (170), Expect(2) = 5e-16 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH +LR EAD A E KLL+SLIE+VC+CHD GD A+ELLVLKT L A S Sbjct: 109 QRLIAHGFLRGEADSSGGAPEAKLLASLIEAVCKCHDFGDDAVELLVLKTLLSAVTS 165 Score = 41.2 bits (95), Expect(2) = 5e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 168 LRIHGDCLLLIVRTCYDIYL 187 >XP_014630702.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Glycine max] Length = 1782 Score = 73.9 bits (180), Expect(2) = 5e-16 Identities = 40/59 (67%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 220 QGIVAHEYLRDEAD--LGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD G+ A E KLLSSLIESVC+CHD GD AMELLVLKT L A S Sbjct: 108 QKLIAHGYLRGEADPDSGAAAPEAKLLSSLIESVCKCHDFGDDAMELLVLKTLLSAVTS 166 Score = 37.4 bits (85), Expect(2) = 5e-16 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGD LL+ VRTCY+IYL Sbjct: 169 LRIHGDSLLLIVRTCYDIYL 188 >XP_003521643.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Glycine max] KRH65253.1 hypothetical protein GLYMA_03G022900 [Glycine max] Length = 1782 Score = 73.9 bits (180), Expect(2) = 5e-16 Identities = 40/59 (67%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 220 QGIVAHEYLRDEAD--LGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD G+ A E KLLSSLIESVC+CHD GD AMELLVLKT L A S Sbjct: 109 QKLIAHGYLRGEADPASGAAAPEAKLLSSLIESVCKCHDFGDDAMELLVLKTLLSAVTS 167 Score = 37.4 bits (85), Expect(2) = 5e-16 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGD LL+ VRTCY+IYL Sbjct: 170 LRIHGDSLLLIVRTCYDIYL 189 >XP_016198049.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Arachis ipaensis] Length = 1793 Score = 69.7 bits (169), Expect(2) = 7e-16 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD E KLL++LIESVC+CHDLGD A+ELLVLK+ L A S Sbjct: 116 QKLIAHGYLRGEADPAGGCPEAKLLANLIESVCKCHDLGDDAVELLVLKSLLSAVTS 172 Score = 41.2 bits (95), Expect(2) = 7e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 175 LRIHGDCLLLIVRTCYDIYL 194 >XP_004492642.1 PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Cicer arietinum] Length = 1788 Score = 69.7 bits (169), Expect(2) = 7e-16 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++A YLR EAD E+K L+SLIESVC+CHDLGD AMELLVLKT L A S Sbjct: 113 QKLIALGYLRGEADAAGECPESKFLASLIESVCKCHDLGDDAMELLVLKTLLSAVTS 169 Score = 41.2 bits (95), Expect(2) = 7e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 172 LRIHGDCLLLIVRTCYDIYL 191 >XP_015961466.1 PREDICTED: LOW QUALITY PROTEIN: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Arachis duranensis] Length = 1783 Score = 69.7 bits (169), Expect(2) = 7e-16 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -2 Query: 220 QGIVAHEYLRDEADLGSTAGETKLLSSLIESVCECHDLGDKAMELLVLKTFLFASDS 50 Q ++AH YLR EAD E KLL++LIESVC+CHDLGD A+ELLVLK+ L A S Sbjct: 116 QKLIAHGYLRGEADPAGGCPEAKLLANLIESVCKCHDLGDDAVELLVLKSLLSAVTS 172 Score = 41.2 bits (95), Expect(2) = 7e-16 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 60 LRIHGDCLLMKVRTCYNIYL 1 LRIHGDCLL+ VRTCY+IYL Sbjct: 175 LRIHGDCLLLIVRTCYDIYL 194