BLASTX nr result
ID: Glycyrrhiza32_contig00029063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00029063 (737 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 2e-21 KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650... 102 3e-21 XP_016188951.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 8e-21 XP_015954426.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 8e-21 OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifo... 86 1e-15 XP_018819032.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 8e-15 XP_015886716.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-14 CDP14158.1 unnamed protein product [Coffea canephora] 80 1e-13 XP_007203355.1 hypothetical protein PRUPE_ppa020478mg [Prunus pe... 80 2e-13 ONH97838.1 hypothetical protein PRUPE_7G213300 [Prunus persica] 80 2e-13 CDP03192.1 unnamed protein product [Coffea canephora] 79 4e-13 XP_009352615.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 1e-12 EEF48110.1 pentatricopeptide repeat-containing protein, putative... 77 2e-12 XP_008352364.2 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-12 XP_015571628.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-12 XP_008337673.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-12 XP_016651481.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 3e-12 KVI11106.1 Pentatricopeptide repeat-containing protein [Cynara c... 75 8e-12 XP_011087320.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-11 XP_011087319.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-11 >XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Lupinus angustifolius] Length = 978 Score = 103 bits (256), Expect = 2e-21 Identities = 46/75 (61%), Positives = 57/75 (76%) Frame = -2 Query: 307 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVP 128 GDC + +LNEG++IH H +K+GVD HFWISL+NF AKCG ++A Q+L +MPEQ V Sbjct: 111 GDCALRESLNEGMAIHGHRIKNGVDQDTHFWISLINFYAKCGCHSYARQVLDEMPEQDVV 170 Query: 127 SWTALIQGFGAQDNG 83 SWTALIQGF Q NG Sbjct: 171 SWTALIQGFVGQGNG 185 >KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650 family [Cajanus cajan] Length = 815 Score = 102 bits (254), Expect = 3e-21 Identities = 44/75 (58%), Positives = 59/75 (78%) Frame = -2 Query: 307 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVP 128 GDCT+ ALN+G +IH H LK+GV+P +HFW SL+NF AKCG+P++ ++L ++PEQ V Sbjct: 10 GDCTLREALNDGKAIHGHQLKNGVEPDSHFWASLINFYAKCGYPSYGRRVLDEVPEQDVV 69 Query: 127 SWTALIQGFGAQDNG 83 SWTALIQG AQ +G Sbjct: 70 SWTALIQGLVAQGDG 84 >XP_016188951.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188952.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188953.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188954.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188955.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] Length = 963 Score = 101 bits (251), Expect = 8e-21 Identities = 45/75 (60%), Positives = 57/75 (76%) Frame = -2 Query: 307 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVP 128 G+C + ALNEG +IH H +K+GVDP +HFW+SL+N AKC + ++A Q L +MPEQ V Sbjct: 95 GNCALRGALNEGKAIHGHQIKTGVDPDSHFWVSLINLYAKCDYSSYACQALDEMPEQDVV 154 Query: 127 SWTALIQGFGAQDNG 83 SWTALIQGF AQ NG Sbjct: 155 SWTALIQGFVAQGNG 169 >XP_015954426.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954427.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954428.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954429.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] Length = 963 Score = 101 bits (251), Expect = 8e-21 Identities = 45/75 (60%), Positives = 57/75 (76%) Frame = -2 Query: 307 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVP 128 G+C + ALNEG +IH H +K+GVDP +HFW+SL+N AKC + ++A Q L +MPEQ V Sbjct: 95 GNCALRGALNEGKAIHGHQIKTGVDPDSHFWVSLINLYAKCDYSSYACQALDEMPEQDVV 154 Query: 127 SWTALIQGFGAQDNG 83 SWTALIQGF AQ NG Sbjct: 155 SWTALIQGFVAQGNG 169 >OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifolius] Length = 856 Score = 86.3 bits (212), Expect = 1e-15 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = -2 Query: 271 LSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSWTALIQGFGAQ 92 ++IH H +K+GVD HFWISL+NF AKCG ++A Q+L +MPEQ V SWTALIQGF Q Sbjct: 1 MAIHGHRIKNGVDQDTHFWISLINFYAKCGCHSYARQVLDEMPEQDVVSWTALIQGFVGQ 60 Query: 91 DNG 83 NG Sbjct: 61 GNG 63 >XP_018819032.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819033.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819034.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819035.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819036.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819037.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819038.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819039.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819040.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] XP_018819042.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Juglans regia] Length = 1004 Score = 84.0 bits (206), Expect = 8e-15 Identities = 38/73 (52%), Positives = 50/73 (68%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +LNEG +IH +K G+DP +H W+SL+N AKCG PT A ++L +MPE+ V SW Sbjct: 137 CASEGSLNEGRTIHGQVIKKGIDPDSHLWVSLINAYAKCGSPTCARRVLEEMPERDVVSW 196 Query: 121 TALIQGFGAQDNG 83 TALIQG A+ G Sbjct: 197 TALIQGHVAEGYG 209 >XP_015886716.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Ziziphus jujuba] XP_015886717.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Ziziphus jujuba] XP_015886718.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Ziziphus jujuba] Length = 975 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/73 (50%), Positives = 50/73 (68%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C LNE ++IH ++SG+DP +H W+SL+N AKCG P A ++L +MPE+ V SW Sbjct: 108 CASKRCLNEAMAIHGQVIRSGIDPDSHLWVSLVNVYAKCGRPVIAWKVLDKMPERDVVSW 167 Query: 121 TALIQGFGAQDNG 83 TALIQGF A+ G Sbjct: 168 TALIQGFVAEGYG 180 >CDP14158.1 unnamed protein product [Coffea canephora] Length = 1008 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/73 (50%), Positives = 51/73 (69%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +N LNEG H + +K G+DP +H ++SL+NF AKCG +FA ++L +MPE+ V SW Sbjct: 140 CAVNLCLNEGKVFHANLIKIGIDPDSHLFVSLINFYAKCGALSFARRVLDEMPEKDVVSW 199 Query: 121 TALIQGFGAQDNG 83 TALI GF A+ G Sbjct: 200 TALISGFVAEGLG 212 >XP_007203355.1 hypothetical protein PRUPE_ppa020478mg [Prunus persica] Length = 872 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/67 (52%), Positives = 47/67 (70%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C + +LNEG +IH +K+G+DP H W+SL+N AKCG +A ++L +MPEQ V SW Sbjct: 5 CVLQGSLNEGKAIHGQVIKNGIDPDLHLWVSLVNVYAKCGDCGYARKVLDEMPEQDVVSW 64 Query: 121 TALIQGF 101 T LIQGF Sbjct: 65 TTLIQGF 71 >ONH97838.1 hypothetical protein PRUPE_7G213300 [Prunus persica] Length = 989 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/67 (52%), Positives = 47/67 (70%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C + +LNEG +IH +K+G+DP H W+SL+N AKCG +A ++L +MPEQ V SW Sbjct: 122 CVLQGSLNEGKAIHGQVIKNGIDPDLHLWVSLVNVYAKCGDCGYARKVLDEMPEQDVVSW 181 Query: 121 TALIQGF 101 T LIQGF Sbjct: 182 TTLIQGF 188 >CDP03192.1 unnamed protein product [Coffea canephora] Length = 938 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/73 (49%), Positives = 51/73 (69%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +N LNEG + H + +K G+DP +H ++SL+NF AKCG +FA ++ +MPE+ V SW Sbjct: 170 CAVNLCLNEGKARHANLIKIGIDPDSHLFVSLINFYAKCGALSFARRVFDEMPEKDVVSW 229 Query: 121 TALIQGFGAQDNG 83 TALI GF A+ G Sbjct: 230 TALISGFVAEGLG 242 >XP_009352615.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Pyrus x bretschneideri] XP_009352616.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Pyrus x bretschneideri] Length = 985 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/73 (47%), Positives = 49/73 (67%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +LNEG +IH +K G+DP +H W+SL+N AKCG +A ++L MPE+ V SW Sbjct: 118 CVSLRSLNEGKAIHGQVIKEGIDPDSHLWVSLVNVYAKCGDSGYARKVLDVMPERDVVSW 177 Query: 121 TALIQGFGAQDNG 83 T+LIQGF + +G Sbjct: 178 TSLIQGFVVEGSG 190 >EEF48110.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 885 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/74 (47%), Positives = 50/74 (67%) Frame = -2 Query: 304 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 125 +C LNEG +IH + +KSG++P +H W+SL+N AKCG FA ++LV M E+ V S Sbjct: 102 ECASKGNLNEGTAIHGNVIKSGLEPDSHLWVSLINLYAKCGSLAFARKVLVGMRERDVVS 161 Query: 124 WTALIQGFGAQDNG 83 WTALI G+ ++ G Sbjct: 162 WTALIAGYVSEGCG 175 >XP_008352364.2 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like, partial [Malus domestica] Length = 948 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +LNEG +IH +K G+DP +H W+SL+N AKCG +A +L MPE+ V SW Sbjct: 81 CVSLRSLNEGKAIHGQVIKEGIDPDSHLWVSLVNVYAKCGDSGYARXVLDVMPERDVVSW 140 Query: 121 TALIQGFGAQDNG 83 T+LIQGF + +G Sbjct: 141 TSLIQGFVVEGSG 153 >XP_015571628.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Ricinus communis] XP_015571629.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Ricinus communis] XP_015571630.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Ricinus communis] XP_015571631.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Ricinus communis] Length = 970 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/74 (47%), Positives = 50/74 (67%) Frame = -2 Query: 304 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 125 +C LNEG +IH + +KSG++P +H W+SL+N AKCG FA ++LV M E+ V S Sbjct: 102 ECASKGNLNEGTAIHGNVIKSGLEPDSHLWVSLINLYAKCGSLAFARKVLVGMRERDVVS 161 Query: 124 WTALIQGFGAQDNG 83 WTALI G+ ++ G Sbjct: 162 WTALIAGYVSEGCG 175 >XP_008337673.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Malus domestica] Length = 987 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C +LNEG +IH +K G+DP +H W+SL+N AKCG +A +L MPE+ V SW Sbjct: 120 CVSLRSLNEGKAIHGQVIKEGIDPDSHLWVSLVNVYAKCGDSGYARXVLDVMPERDVVSW 179 Query: 121 TALIQGFGAQDNG 83 T+LIQGF + +G Sbjct: 180 TSLIQGFVVEGSG 192 >XP_016651481.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Prunus mume] Length = 989 Score = 76.3 bits (186), Expect = 3e-12 Identities = 32/67 (47%), Positives = 47/67 (70%) Frame = -2 Query: 301 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 122 C + +LNEG +IH +K+G+DP +H W+SL+N KCG +A ++L +MP++ V SW Sbjct: 122 CVLQGSLNEGKAIHGQVIKNGIDPDSHLWVSLVNVYGKCGDCGYARKVLDEMPDRDVVSW 181 Query: 121 TALIQGF 101 T LIQGF Sbjct: 182 TTLIQGF 188 >KVI11106.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 945 Score = 75.1 bits (183), Expect = 8e-12 Identities = 33/74 (44%), Positives = 49/74 (66%) Frame = -2 Query: 304 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 125 DC N ++NEG +IH+ + S ++ +H W+SL+NF AKCG + A Q+L MP++ V S Sbjct: 78 DCAANRSVNEGKAIHKQIMGSDIELDSHLWVSLINFYAKCGCLSVARQVLADMPQRDVVS 137 Query: 124 WTALIQGFGAQDNG 83 WTAL+ GF + G Sbjct: 138 WTALMSGFVGEGCG 151 >XP_011087320.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Sesamum indicum] Length = 984 Score = 73.2 bits (178), Expect = 4e-11 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 10/99 (10%) Frame = -2 Query: 349 SRKVMGNS-----LNRVSD-----GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLN 200 SR++ G S +NR+ +C LN+G IH +KSG++P H W+SL+N Sbjct: 92 SRRLRGGSESVSDINRLKSYSEVLRNCAAEMYLNKGKVIHCRIIKSGIEPDMHLWVSLIN 151 Query: 199 FSAKCGFPTFAHQMLVQMPEQHVPSWTALIQGFGAQDNG 83 F AKCG ++ + QMP + V SWTALI GF AQ G Sbjct: 152 FYAKCGALESSYHVFDQMPLKDVVSWTALISGFVAQGYG 190 >XP_011087319.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Sesamum indicum] Length = 1003 Score = 73.2 bits (178), Expect = 4e-11 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 10/99 (10%) Frame = -2 Query: 349 SRKVMGNS-----LNRVSD-----GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLN 200 SR++ G S +NR+ +C LN+G IH +KSG++P H W+SL+N Sbjct: 111 SRRLRGGSESVSDINRLKSYSEVLRNCAAEMYLNKGKVIHCRIIKSGIEPDMHLWVSLIN 170 Query: 199 FSAKCGFPTFAHQMLVQMPEQHVPSWTALIQGFGAQDNG 83 F AKCG ++ + QMP + V SWTALI GF AQ G Sbjct: 171 FYAKCGALESSYHVFDQMPLKDVVSWTALISGFVAQGYG 209