BLASTX nr result
ID: Glycyrrhiza32_contig00028699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00028699 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] 117 3e-31 KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] 111 2e-29 KHN32591.1 Putative pentatricopeptide repeat-containing protein,... 115 4e-29 KRH25652.1 hypothetical protein GLYMA_12G118300, partial [Glycin... 115 1e-28 XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 2e-28 KRH08278.1 hypothetical protein GLYMA_16G139800 [Glycine max] KR... 114 3e-28 XP_006599382.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 3e-28 KHN11095.1 Pentatricopeptide repeat-containing protein, mitochon... 114 3e-28 XP_016203492.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-27 KRH39113.1 hypothetical protein GLYMA_09G178400 [Glycine max] 110 1e-27 KHN23731.1 Putative pentatricopeptide repeat-containing protein,... 107 1e-27 KYP59707.1 Pentatricopeptide repeat-containing protein At1g62590... 111 3e-27 KHN43635.1 Pentatricopeptide repeat-containing protein, mitochon... 111 4e-27 KRH08607.1 hypothetical protein GLYMA_16G160700 [Glycine max] 111 4e-27 XP_016163962.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 4e-27 XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago ... 102 4e-27 XP_003548963.3 PREDICTED: pentatricopeptide repeat-containing pr... 111 5e-27 KHN32823.1 Pentatricopeptide repeat-containing protein, partial ... 111 5e-27 XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 7e-27 XP_014623975.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 8e-27 >KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] Length = 246 Score = 117 bits (293), Expect = 3e-31 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 LIKGYHLNVWTY VMI+GLCKEGLFD+ALA+ SKMEDNGCIPNVVT+E IIC+LFE + Sbjct: 171 LIKGYHLNVWTYNVMISGLCKEGLFDEALAMKSKMEDNGCIPNVVTFERIICALFETDEK 230 Query: 19 DKAEKL 2 DKAEKL Sbjct: 231 DKAEKL 236 >KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] Length = 207 Score = 111 bits (278), Expect = 2e-29 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NV+TYT+MINGLC +GL D+ALA+LSKMED GCIPN VT+EI+IC+LFEK N Sbjct: 132 LVKGYRINVYTYTIMINGLCNQGLLDEALAMLSKMEDKGCIPNAVTFEILICALFEKDGN 191 Query: 19 DKAEKL 2 DKAEKL Sbjct: 192 DKAEKL 197 >KHN32591.1 Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 425 Score = 115 bits (288), Expect = 4e-29 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NVWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 342 LVKGYCINVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 401 Query: 19 DKAEKL 2 DKAEKL Sbjct: 402 DKAEKL 407 >KRH25652.1 hypothetical protein GLYMA_12G118300, partial [Glycine max] Length = 540 Score = 115 bits (288), Expect = 1e-28 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NVWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 398 LVKGYCINVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 457 Query: 19 DKAEKL 2 DKAEKL Sbjct: 458 DKAEKL 463 >XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] XP_014624499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] KHN31545.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH09154.1 hypothetical protein GLYMA_16G199700 [Glycine max] Length = 556 Score = 115 bits (287), Expect = 2e-28 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 LIKGYHL++ TYTVMI+G CK GLFD+ALALLSKMEDNGCIPN +T++IIIC+LFEK +N Sbjct: 481 LIKGYHLDIRTYTVMISGFCKAGLFDEALALLSKMEDNGCIPNAITFDIIICALFEKDEN 540 Query: 19 DKAEKL 2 DKAEKL Sbjct: 541 DKAEKL 546 >KRH08278.1 hypothetical protein GLYMA_16G139800 [Glycine max] KRH08279.1 hypothetical protein GLYMA_16G139800 [Glycine max] Length = 511 Score = 114 bits (285), Expect = 3e-28 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L++GY LNVWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 422 LVRGYCLNVWTYTVMISGLCKEGMFDEALAIKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 481 Query: 19 DKAEKL 2 DKAEK+ Sbjct: 482 DKAEKI 487 >XP_006599382.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] KRH08277.1 hypothetical protein GLYMA_16G139800 [Glycine max] Length = 567 Score = 114 bits (285), Expect = 3e-28 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L++GY LNVWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 478 LVRGYCLNVWTYTVMISGLCKEGMFDEALAIKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 537 Query: 19 DKAEKL 2 DKAEK+ Sbjct: 538 DKAEKI 543 >KHN11095.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 580 Score = 114 bits (285), Expect = 3e-28 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L++GY LNVWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 491 LVRGYCLNVWTYTVMISGLCKEGMFDEALAIKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 550 Query: 19 DKAEKL 2 DKAEK+ Sbjct: 551 DKAEKI 556 >XP_016203492.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 560 Score = 112 bits (281), Expect = 1e-27 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = -2 Query: 196 IKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDND 17 IKGY NVWTYT+MINGLCKEGL +ALA LSKMEDNGC+PN VTYEIII +LFEKG+ND Sbjct: 482 IKGYRPNVWTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPNAVTYEIIIRALFEKGEND 541 Query: 16 KAEKL 2 AEKL Sbjct: 542 NAEKL 546 >KRH39113.1 hypothetical protein GLYMA_09G178400 [Glycine max] Length = 332 Score = 110 bits (274), Expect = 1e-27 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NV+TYT+MINGLCK+GL D+ALA+LSKME NGCIPN T+EI+IC+LFEK N Sbjct: 257 LVKGYCINVYTYTIMINGLCKQGLLDEALAMLSKMEGNGCIPNAFTFEILICALFEKDGN 316 Query: 19 DKAEKL 2 DKAEKL Sbjct: 317 DKAEKL 322 >KHN23731.1 Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 215 Score = 107 bits (267), Expect = 1e-27 Identities = 48/66 (72%), Positives = 58/66 (87%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NV+TYT+MINGLCK+ L D+ALA+LSKME NGCIPN T+EI+IC+LFEK N Sbjct: 140 LVKGYCINVYTYTIMINGLCKQDLLDEALAMLSKMEGNGCIPNAFTFEILICALFEKDGN 199 Query: 19 DKAEKL 2 DKAEKL Sbjct: 200 DKAEKL 205 >KYP59707.1 Pentatricopeptide repeat-containing protein At1g62590 family [Cajanus cajan] Length = 475 Score = 111 bits (277), Expect = 3e-27 Identities = 51/66 (77%), Positives = 59/66 (89%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 LIKG+HLNVWTY VMINGLCK GLFD+ALAL SKME+ GCIP+ +T+EIII +LFEK +N Sbjct: 400 LIKGHHLNVWTYNVMINGLCKVGLFDEALALRSKMEEKGCIPDAITFEIIISALFEKDEN 459 Query: 19 DKAEKL 2 DKAEKL Sbjct: 460 DKAEKL 465 >KHN43635.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 794 Score = 111 bits (278), Expect = 4e-27 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY +NV+TYT+MINGLC +GL D+ALA+LSKMED GCIPN VT+EI+IC+LFEK N Sbjct: 719 LVKGYRINVYTYTIMINGLCNQGLLDEALAMLSKMEDKGCIPNAVTFEILICALFEKDGN 778 Query: 19 DKAEKL 2 DKAEKL Sbjct: 779 DKAEKL 784 Score = 103 bits (257), Expect = 3e-24 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L KGYHLNV+TY VMING CK+GL ++AL +LSKMEDNGCIPN T++III +LF+K +N Sbjct: 270 LTKGYHLNVYTYNVMINGHCKQGLLEEALTMLSKMEDNGCIPNTFTFDIIINALFKKDEN 329 Query: 19 DKAEKL 2 DKAEKL Sbjct: 330 DKAEKL 335 >KRH08607.1 hypothetical protein GLYMA_16G160700 [Glycine max] Length = 561 Score = 111 bits (277), Expect = 4e-27 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY ++VWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SL EK +N Sbjct: 463 LVKGYCIDVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLLEKDEN 522 Query: 19 DKAEKL 2 DKAEKL Sbjct: 523 DKAEKL 528 >XP_016163962.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 127 Score = 103 bits (257), Expect = 4e-27 Identities = 49/65 (75%), Positives = 56/65 (86%) Frame = -2 Query: 196 IKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDND 17 IKGY +V TYT+MINGLCKEGL +ALA LSKMEDNGC+P+ VTYEIII +LFEKG+ND Sbjct: 51 IKGYRPDVKTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPDAVTYEIIIGALFEKGEND 110 Query: 16 KAEKL 2 AEKL Sbjct: 111 NAEKL 115 >XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26915.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 103 Score = 102 bits (255), Expect = 4e-27 Identities = 48/66 (72%), Positives = 57/66 (86%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY+L+V+ YTVMI G C +GLFD+ALALLSKME+NGCIP+ TYEIII SLFEK +N Sbjct: 28 LVKGYNLDVYAYTVMIQGFCDKGLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 87 Query: 19 DKAEKL 2 D AEKL Sbjct: 88 DMAEKL 93 >XP_003548963.3 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] Length = 593 Score = 111 bits (277), Expect = 5e-27 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY ++VWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SL EK +N Sbjct: 494 LVKGYCIDVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLLEKDEN 553 Query: 19 DKAEKL 2 DKAEKL Sbjct: 554 DKAEKL 559 >KHN32823.1 Pentatricopeptide repeat-containing protein, partial [Glycine soja] Length = 654 Score = 111 bits (277), Expect = 5e-27 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KGY ++VWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SL EK +N Sbjct: 556 LVKGYCIDVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLLEKDEN 615 Query: 19 DKAEKL 2 DKAEKL Sbjct: 616 DKAEKL 621 >XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012574713.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 547 Score = 110 bits (275), Expect = 7e-27 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 LIKGYHL+V TYTVMI+GLCKEGLFD+ LALLSKMEDNGCIP+ +TYEI+I +LFEKG Sbjct: 472 LIKGYHLDVLTYTVMISGLCKEGLFDEVLALLSKMEDNGCIPDAITYEIVILALFEKGKI 531 Query: 19 DKAEKL 2 D AEKL Sbjct: 532 DMAEKL 537 >XP_014623975.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Glycine max] XP_014623976.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Glycine max] KRH08635.1 hypothetical protein GLYMA_16G162700 [Glycine max] Length = 505 Score = 110 bits (274), Expect = 8e-27 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVWTYTVMINGLCKEGLFDQALALLSKMEDNGCIPNVVTYEIIICSLFEKGDN 20 L+KG ++VWTYTVMI+GLCKEG+FD+ALA+ SKMEDNGCIPN VT+EIII SLFEK +N Sbjct: 422 LVKGCCIDVWTYTVMISGLCKEGMFDEALAIKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 481 Query: 19 DKAEKL 2 DKAEKL Sbjct: 482 DKAEKL 487