BLASTX nr result
ID: Glycyrrhiza32_contig00028619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00028619 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004502624.1 PREDICTED: probable protein phosphatase 2C 13 [Ci... 59 7e-08 GAU51008.1 hypothetical protein TSUD_377350, partial [Trifolium ... 56 8e-07 >XP_004502624.1 PREDICTED: probable protein phosphatase 2C 13 [Cicer arietinum] XP_004502625.1 PREDICTED: probable protein phosphatase 2C 13 [Cicer arietinum] XP_004502626.1 PREDICTED: probable protein phosphatase 2C 13 [Cicer arietinum] Length = 369 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 SADNITCIVVRFHHQTTIPANPDKAGPSSSQ 95 SADNITCIVVRFHH+ PANPDKAGP+SSQ Sbjct: 337 SADNITCIVVRFHHEKAHPANPDKAGPASSQ 367 >GAU51008.1 hypothetical protein TSUD_377350, partial [Trifolium subterraneum] Length = 305 Score = 55.8 bits (133), Expect = 8e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 SADNITCIVVRFHHQTTIPANPDKAGPSSSQ 95 SADNITCIVVRF+H+ PANPDKAGP+SSQ Sbjct: 273 SADNITCIVVRFNHEKRPPANPDKAGPASSQ 303