BLASTX nr result
ID: Glycyrrhiza32_contig00028300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00028300 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19275.1 hypothetical protein TSUD_335600 [Trifolium subterran... 64 8e-10 GAU43626.1 hypothetical protein TSUD_185190 [Trifolium subterran... 55 1e-06 XP_013444455.1 hypothetical protein MTR_8g020965 [Medicago trunc... 51 2e-06 >GAU19275.1 hypothetical protein TSUD_335600 [Trifolium subterraneum] Length = 438 Score = 63.9 bits (154), Expect = 8e-10 Identities = 36/54 (66%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = -3 Query: 203 HGRLNRQRPVPHSQHP----LQSRAISPLAXXXXXXXXXXXXSLDVQSVRTDMT 54 HGRLNRQRPVPHSQH +QSRAISPLA SLDVQSVRTDMT Sbjct: 385 HGRLNRQRPVPHSQHAPLPYIQSRAISPLARRSSFRSSSTMSSLDVQSVRTDMT 438 >GAU43626.1 hypothetical protein TSUD_185190 [Trifolium subterraneum] Length = 609 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 84 RCSVCSDGYDVACHHHGNLIIAGIL 10 RCSVCSDGYDVACHHHGNLIIA L Sbjct: 324 RCSVCSDGYDVACHHHGNLIIAEFL 348 >XP_013444455.1 hypothetical protein MTR_8g020965 [Medicago truncatula] KEH18480.1 hypothetical protein MTR_8g020965 [Medicago truncatula] Length = 81 Score = 51.2 bits (121), Expect = 2e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 206 VHGRLNRQRPVPHSQHPLQSRAISP 132 VHGRLNRQRPVPHSQHPLQ AISP Sbjct: 57 VHGRLNRQRPVPHSQHPLQYWAISP 81