BLASTX nr result
ID: Glycyrrhiza32_contig00028171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00028171 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW21206.1 hypothetical protein TanjilG_30807 [Lupinus angustifo... 72 9e-15 EPS67914.1 hypothetical protein M569_06859, partial [Genlisea au... 75 2e-13 KGN62159.1 hypothetical protein Csa_2G302250 [Cucumis sativus] 75 2e-13 XP_016902607.1 PREDICTED: callose synthase 5-like [Cucumis melo] 75 2e-13 APA20146.1 callose synthase 5 [Populus tomentosa] 75 2e-13 KCW54228.1 hypothetical protein EUGRSUZ_I00208 [Eucalyptus grandis] 75 2e-13 GAV58897.1 Glucan_synthase domain-containing protein/DUF605 doma... 75 2e-13 EEF32656.1 transferase, transferring glycosyl groups, putative [... 75 2e-13 EYU23770.1 hypothetical protein MIMGU_mgv1a000084mg [Erythranthe... 75 2e-13 EYU18041.1 hypothetical protein MIMGU_mgv1a000082mg [Erythranthe... 75 2e-13 XP_011099745.1 PREDICTED: callose synthase 5 [Sesamum indicum] 75 2e-13 XP_012828861.1 PREDICTED: callose synthase 5-like [Erythranthe g... 75 2e-13 KHN31144.1 Callose synthase 5 [Glycine soja] 75 2e-13 XP_006382841.1 glycosyl transferase family 48 family protein [Po... 75 2e-13 XP_010088650.1 Callose synthase 5 [Morus notabilis] EXB36810.1 C... 75 2e-13 XP_014630359.1 PREDICTED: callose synthase 5-like [Glycine max] 75 2e-13 XP_018827765.1 PREDICTED: callose synthase 5 [Juglans regia] 75 2e-13 XP_004502937.1 PREDICTED: callose synthase 5 [Cicer arietinum] 75 2e-13 XP_019184499.1 PREDICTED: callose synthase 5-like [Ipomoea nil] 75 2e-13 XP_002274337.1 PREDICTED: callose synthase 5 [Vitis vinifera] 75 2e-13 >OIW21206.1 hypothetical protein TanjilG_30807 [Lupinus angustifolius] Length = 65 Score = 72.4 bits (176), Expect = 9e-15 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKK K Sbjct: 29 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKQK 63 >EPS67914.1 hypothetical protein M569_06859, partial [Genlisea aurea] Length = 501 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 467 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 501 >KGN62159.1 hypothetical protein Csa_2G302250 [Cucumis sativus] Length = 1060 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1026 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1060 >XP_016902607.1 PREDICTED: callose synthase 5-like [Cucumis melo] Length = 1714 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1680 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1714 >APA20146.1 callose synthase 5 [Populus tomentosa] Length = 1801 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1767 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1801 >KCW54228.1 hypothetical protein EUGRSUZ_I00208 [Eucalyptus grandis] Length = 1836 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1802 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1836 >GAV58897.1 Glucan_synthase domain-containing protein/DUF605 domain-containing protein/FKS1_dom1 domain-containing protein [Cephalotus follicularis] Length = 1858 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1824 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1858 >EEF32656.1 transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1864 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1830 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1864 >EYU23770.1 hypothetical protein MIMGU_mgv1a000084mg [Erythranthe guttata] Length = 1867 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1833 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1867 >EYU18041.1 hypothetical protein MIMGU_mgv1a000082mg [Erythranthe guttata] Length = 1869 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1835 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1869 >XP_011099745.1 PREDICTED: callose synthase 5 [Sesamum indicum] Length = 1887 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1853 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1887 >XP_012828861.1 PREDICTED: callose synthase 5-like [Erythranthe guttata] Length = 1889 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1855 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1889 >KHN31144.1 Callose synthase 5 [Glycine soja] Length = 1904 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1870 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1904 >XP_006382841.1 glycosyl transferase family 48 family protein [Populus trichocarpa] ERP60638.1 glycosyl transferase family 48 family protein [Populus trichocarpa] Length = 1906 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1872 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1906 >XP_010088650.1 Callose synthase 5 [Morus notabilis] EXB36810.1 Callose synthase 5 [Morus notabilis] Length = 1912 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1878 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1912 >XP_014630359.1 PREDICTED: callose synthase 5-like [Glycine max] Length = 1914 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1880 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1914 >XP_018827765.1 PREDICTED: callose synthase 5 [Juglans regia] Length = 1915 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1881 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1915 >XP_004502937.1 PREDICTED: callose synthase 5 [Cicer arietinum] Length = 1916 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1882 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1916 >XP_019184499.1 PREDICTED: callose synthase 5-like [Ipomoea nil] Length = 1918 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1884 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1918 >XP_002274337.1 PREDICTED: callose synthase 5 [Vitis vinifera] Length = 1918 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 327 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 223 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK Sbjct: 1884 WFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKNK 1918