BLASTX nr result
ID: Glycyrrhiza32_contig00028160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00028160 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016184019.1 PREDICTED: macrophage migration inhibitory factor... 60 5e-10 XP_015950484.1 PREDICTED: macrophage migration inhibitory factor... 60 5e-10 AFK35159.1 unknown [Lotus japonicus] 58 4e-09 KYP42791.1 Macrophage migration inhibitory factor isogeny [Cajan... 57 9e-09 XP_003516986.1 PREDICTED: macrophage migration inhibitory factor... 57 9e-09 KYP63614.1 Macrophage migration inhibitory factor isogeny [Cajan... 56 2e-08 XP_007134640.1 hypothetical protein PHAVU_010G064100g [Phaseolus... 56 2e-08 XP_003522191.1 PREDICTED: macrophage migration inhibitory factor... 56 2e-08 XP_014492470.1 PREDICTED: macrophage migration inhibitory factor... 55 5e-08 XP_017405348.1 PREDICTED: macrophage migration inhibitory factor... 55 5e-08 XP_003552282.1 PREDICTED: macrophage migration inhibitory factor... 54 1e-07 ACU19241.1 unknown [Glycine max] 54 1e-07 ACU19063.1 unknown [Glycine max] 54 1e-07 XP_006602687.1 PREDICTED: uncharacterized protein LOC100790725 i... 54 1e-07 XP_007140198.1 hypothetical protein PHAVU_008G092400g [Phaseolus... 54 1e-07 XP_003623388.1 macrophage migration inhibition factor-like prote... 54 2e-07 XP_014492430.1 PREDICTED: macrophage migration inhibitory factor... 53 4e-07 XP_017441801.1 PREDICTED: macrophage migration inhibitory factor... 53 4e-07 XP_010091880.1 hypothetical protein L484_009496 [Morus notabilis... 52 8e-07 XP_015897419.1 PREDICTED: macrophage migration inhibitory factor... 52 1e-06 >XP_016184019.1 PREDICTED: macrophage migration inhibitory factor homolog [Arachis ipaensis] Length = 112 Score = 60.1 bits (144), Expect = 5e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT FR NSKM Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFRSNSKM 112 >XP_015950484.1 PREDICTED: macrophage migration inhibitory factor homolog [Arachis duranensis] Length = 112 Score = 60.1 bits (144), Expect = 5e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT FR NSKM Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFRSNSKM 112 >AFK35159.1 unknown [Lotus japonicus] Length = 112 Score = 57.8 bits (138), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT+FR+ SK+ Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTLFRNKSKL 112 >KYP42791.1 Macrophage migration inhibitory factor isogeny [Cajanus cajan] Length = 112 Score = 57.0 bits (136), Expect = 9e-09 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTTVFR SKM Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTVFRTKSKM 112 >XP_003516986.1 PREDICTED: macrophage migration inhibitory factor homolog [Glycine max] KHN31742.1 Macrophage migration inhibitory factor like [Glycine soja] KRH76036.1 hypothetical protein GLYMA_01G126200 [Glycine max] Length = 112 Score = 57.0 bits (136), Expect = 9e-09 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTTVFR SKM Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTVFRTKSKM 112 >KYP63614.1 Macrophage migration inhibitory factor isogeny [Cajanus cajan] Length = 112 Score = 56.2 bits (134), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTT FR NSK+ Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTAFRTNSKI 112 >XP_007134640.1 hypothetical protein PHAVU_010G064100g [Phaseolus vulgaris] ESW06634.1 hypothetical protein PHAVU_010G064100g [Phaseolus vulgaris] Length = 112 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQ+ LSIPRTRFFLKVFDTTVFR SKM Sbjct: 82 GTILQTNLSIPRTRFFLKVFDTTVFRTKSKM 112 >XP_003522191.1 PREDICTED: macrophage migration inhibitory factor homolog [Glycine max] KHN44898.1 Macrophage migration inhibitory factor like [Glycine soja] KRH65566.1 hypothetical protein GLYMA_03G046200 [Glycine max] Length = 112 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTT+FR SKM Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTLFRTKSKM 112 >XP_014492470.1 PREDICTED: macrophage migration inhibitory factor homolog [Vigna radiata var. radiata] Length = 112 Score = 55.1 bits (131), Expect = 5e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT F SKM Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFSTKSKM 112 >XP_017405348.1 PREDICTED: macrophage migration inhibitory factor homolog [Vigna angularis] KOM25229.1 hypothetical protein LR48_Vigan62s000600 [Vigna angularis] BAT84010.1 hypothetical protein VIGAN_04127100 [Vigna angularis var. angularis] Length = 112 Score = 55.1 bits (131), Expect = 5e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT F SKM Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFSTKSKM 112 >XP_003552282.1 PREDICTED: macrophage migration inhibitory factor homolog isoform X2 [Glycine max] KRH00337.1 hypothetical protein GLYMA_18G207400 [Glycine max] Length = 112 Score = 54.3 bits (129), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFD + FR NSKM Sbjct: 82 GTILQSNLSIPRTRFFLKVFDVSAFRTNSKM 112 >ACU19241.1 unknown [Glycine max] Length = 112 Score = 54.3 bits (129), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFD + FR NSKM Sbjct: 82 GTILQSNLSIPRTRFFLKVFDVSAFRTNSKM 112 >ACU19063.1 unknown [Glycine max] Length = 112 Score = 54.3 bits (129), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFF KVFDTT+FR SKM Sbjct: 82 GTILQSNLSIPRTRFFFKVFDTTLFRTKSKM 112 >XP_006602687.1 PREDICTED: uncharacterized protein LOC100790725 isoform X1 [Glycine max] KHN40693.1 hypothetical protein glysoja_001191 [Glycine soja] KRH00338.1 hypothetical protein GLYMA_18G207400 [Glycine max] Length = 122 Score = 54.3 bits (129), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFD + FR NSKM Sbjct: 92 GTILQSNLSIPRTRFFLKVFDVSAFRTNSKM 122 >XP_007140198.1 hypothetical protein PHAVU_008G092400g [Phaseolus vulgaris] ESW12192.1 hypothetical protein PHAVU_008G092400g [Phaseolus vulgaris] Length = 112 Score = 53.9 bits (128), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT F S+M Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFSTKSRM 112 >XP_003623388.1 macrophage migration inhibition factor-like protein [Medicago truncatula] AES79606.1 macrophage migration inhibition factor-like protein [Medicago truncatula] Length = 112 Score = 53.5 bits (127), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQSKLSIPRTRFFLKVFDTT F SK+ Sbjct: 82 GTILQSKLSIPRTRFFLKVFDTTAFPTRSKL 112 >XP_014492430.1 PREDICTED: macrophage migration inhibitory factor homolog [Vigna radiata var. radiata] Length = 112 Score = 52.8 bits (125), Expect = 4e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTT+FR S + Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTLFRPKSNL 112 >XP_017441801.1 PREDICTED: macrophage migration inhibitory factor homolog [Vigna angularis] KOM57972.1 hypothetical protein LR48_Vigan11g100500 [Vigna angularis] BAT97506.1 hypothetical protein VIGAN_09096600 [Vigna angularis var. angularis] Length = 112 Score = 52.8 bits (125), Expect = 4e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTILQS LSIPRTRFFLKVFDTT+FR S + Sbjct: 82 GTILQSNLSIPRTRFFLKVFDTTLFRTKSNL 112 >XP_010091880.1 hypothetical protein L484_009496 [Morus notabilis] EXB46347.1 hypothetical protein L484_009496 [Morus notabilis] Length = 112 Score = 52.0 bits (123), Expect = 8e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTIL+SKLSIPRTRFFLKV+DTT+ R+ SK+ Sbjct: 82 GTILESKLSIPRTRFFLKVYDTTLGRNKSKL 112 >XP_015897419.1 PREDICTED: macrophage migration inhibitory factor homolog [Ziziphus jujuba] Length = 112 Score = 51.6 bits (122), Expect = 1e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 224 GTILQSKLSIPRTRFFLKVFDTTVFRHNSKM 132 GTIL +KLS+PRTRFFLKVFDTT R NSK+ Sbjct: 82 GTILHAKLSVPRTRFFLKVFDTTAGRTNSKL 112