BLASTX nr result
ID: Glycyrrhiza32_contig00027973
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027973 (204 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_055984888.1 hypothetical protein [Pseudomonas sp. Leaf83] KQO... 75 1e-14 >WP_055984888.1 hypothetical protein [Pseudomonas sp. Leaf83] KQO41653.1 hypothetical protein ASF15_19675 [Pseudomonas sp. Leaf83] Length = 330 Score = 75.5 bits (184), Expect = 1e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 MLTDLQAIDYEQPLSILIGENGSGKSQALADIAEAYIS 2 MLTDLQAIDYEQPLSILIGENGSGKSQALADIAEAYIS Sbjct: 1 MLTDLQAIDYEQPLSILIGENGSGKSQALADIAEAYIS 38