BLASTX nr result
ID: Glycyrrhiza32_contig00027693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027693 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011036636.1 PREDICTED: trafficking protein particle complex s... 76 1e-14 XP_017258153.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 KVH96484.1 TRAPP II complex, Trs120, partial [Cynara cardunculus... 73 2e-13 CAN71170.1 hypothetical protein VITISV_022666 [Vitis vinifera] 73 2e-13 XP_016473487.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 XP_009778820.1 PREDICTED: uncharacterized protein LOC104228113 i... 73 2e-13 XP_009618490.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 XP_019176998.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 CBI21099.3 unnamed protein product, partial [Vitis vinifera] 73 2e-13 ONK76680.1 uncharacterized protein A4U43_C03F30920 [Asparagus of... 73 2e-13 KOM48725.1 hypothetical protein LR48_Vigan07g242900 [Vigna angul... 73 2e-13 XP_002324891.2 hypothetical protein POPTR_0018s02220g [Populus t... 73 2e-13 EYU32375.1 hypothetical protein MIMGU_mgv1a000384mg [Erythranthe... 73 2e-13 OAY69410.1 Trafficking protein particle complex II-specific subu... 73 2e-13 XP_010244786.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 XP_011039615.1 PREDICTED: trafficking protein particle complex s... 73 2e-13 XP_011036637.1 PREDICTED: trafficking protein particle complex s... 73 2e-13 XP_019247897.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 XP_016574933.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 XP_016473486.1 PREDICTED: trafficking protein particle complex I... 73 2e-13 >XP_011036636.1 PREDICTED: trafficking protein particle complex subunit 9-like isoform X1 [Populus euphratica] Length = 1187 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 187 FQVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 FQVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 209 FQVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 244 >XP_017258153.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X4 [Daucus carota subsp. sativus] Length = 1183 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 196 PQRFQVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 P QVIKAKKRRLGRAQKTIGDYCLL+GSPVDANAHYS Sbjct: 196 PLDSQVIKAKKRRLGRAQKTIGDYCLLSGSPVDANAHYS 234 >KVH96484.1 TRAPP II complex, Trs120, partial [Cynara cardunculus var. scolymus] Length = 453 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 240 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 274 >CAN71170.1 hypothetical protein VITISV_022666 [Vitis vinifera] Length = 657 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 549 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 583 >XP_016473487.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X4 [Nicotiana tabacum] Length = 1023 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 41 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 75 >XP_009778820.1 PREDICTED: uncharacterized protein LOC104228113 isoform X3 [Nicotiana sylvestris] XP_016510295.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X3 [Nicotiana tabacum] Length = 1023 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 41 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 75 >XP_009618490.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X3 [Nicotiana tomentosiformis] Length = 1023 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 41 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 75 >XP_019176998.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X3 [Ipomoea nil] Length = 1026 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 41 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 75 >CBI21099.3 unnamed protein product, partial [Vitis vinifera] Length = 1056 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >ONK76680.1 uncharacterized protein A4U43_C03F30920 [Asparagus officinalis] Length = 1064 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 59 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 93 >KOM48725.1 hypothetical protein LR48_Vigan07g242900 [Vigna angularis] Length = 1078 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 88 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 122 >XP_002324891.2 hypothetical protein POPTR_0018s02220g [Populus trichocarpa] EEF03456.2 hypothetical protein POPTR_0018s02220g [Populus trichocarpa] Length = 1087 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 110 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 144 >EYU32375.1 hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata] Length = 1153 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >OAY69410.1 Trafficking protein particle complex II-specific subunit 1 [Ananas comosus] Length = 1163 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 205 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 239 >XP_010244786.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X2 [Nelumbo nucifera] Length = 1180 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >XP_011039615.1 PREDICTED: trafficking protein particle complex subunit 9 [Populus euphratica] Length = 1182 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >XP_011036637.1 PREDICTED: trafficking protein particle complex subunit 9-like isoform X2 [Populus euphratica] Length = 1183 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >XP_019247897.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X2 [Nicotiana attenuata] OIT02575.1 trafficking protein particle complex ii-specific subunit 120-like protein [Nicotiana attenuata] Length = 1185 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >XP_016574933.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog [Capsicum annuum] Length = 1185 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240 >XP_016473486.1 PREDICTED: trafficking protein particle complex II-specific subunit 120 homolog isoform X3 [Nicotiana tabacum] Length = 1185 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 184 QVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 80 +VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS Sbjct: 206 EVIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYS 240