BLASTX nr result
ID: Glycyrrhiza32_contig00027470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027470 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19191.1 hypothetical protein TSUD_198730 [Trifolium subterran... 75 3e-14 GAU19190.1 hypothetical protein TSUD_198720 [Trifolium subterran... 64 4e-10 >GAU19191.1 hypothetical protein TSUD_198730 [Trifolium subterraneum] Length = 191 Score = 74.7 bits (182), Expect = 3e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 181 MKQGEETDYLAAASLFWESSLFTECHAAGTGISTRA 288 MKQGEETDYLAAASLFWES LFTECHAAGTGISTRA Sbjct: 1 MKQGEETDYLAAASLFWESCLFTECHAAGTGISTRA 36 >GAU19190.1 hypothetical protein TSUD_198720 [Trifolium subterraneum] Length = 170 Score = 63.5 bits (153), Expect = 4e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GISSAIDEAVIGLAWLGWSHWNSGLEEEGLL 93 GISSAIDEAVIGLAWLGWSH NSGLEEEGLL Sbjct: 140 GISSAIDEAVIGLAWLGWSHRNSGLEEEGLL 170