BLASTX nr result
ID: Glycyrrhiza32_contig00027393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027393 (204 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK38939.1 unknown [Lotus japonicus] 61 8e-10 XP_014491521.1 PREDICTED: myb-related protein Myb4-like [Vigna r... 55 2e-07 XP_012569580.1 PREDICTED: transcription factor MYB114-like [Cice... 55 2e-07 KOM55674.1 hypothetical protein LR48_Vigan10g156600 [Vigna angul... 54 4e-07 XP_013450568.1 myb transcription factor [Medicago truncatula] KE... 53 1e-06 XP_007147213.1 hypothetical protein PHAVU_006G105200g [Phaseolus... 52 2e-06 BAT87925.1 hypothetical protein VIGAN_05135000 [Vigna angularis ... 52 2e-06 XP_015968249.1 PREDICTED: myb-related protein Myb4-like [Arachis... 50 1e-05 >AFK38939.1 unknown [Lotus japonicus] Length = 201 Score = 61.2 bits (147), Expect = 8e-10 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS 88 ETMGNHG +QISEEMEFWYN+F+KSGQPS Sbjct: 173 ETMGNHGSNQISEEMEFWYNIFIKSGQPS 201 >XP_014491521.1 PREDICTED: myb-related protein Myb4-like [Vigna radiata var. radiata] XP_014491522.1 PREDICTED: myb-related protein Myb4-like [Vigna radiata var. radiata] XP_014491523.1 PREDICTED: myb-related protein Myb4-like [Vigna radiata var. radiata] Length = 222 Score = 55.1 bits (131), Expect = 2e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS*GNGNLG 109 ET NH QISEEMEFWYN+F+KSGQ S N NLG Sbjct: 186 ETEDNHDSCQISEEMEFWYNIFIKSGQTSRDNENLG 221 >XP_012569580.1 PREDICTED: transcription factor MYB114-like [Cicer arietinum] Length = 207 Score = 54.7 bits (130), Expect = 2e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS 88 E +GNH SQISEEMEFWYNVF+KS QPS Sbjct: 179 ENVGNHSSSQISEEMEFWYNVFIKSAQPS 207 >KOM55674.1 hypothetical protein LR48_Vigan10g156600 [Vigna angularis] KOM55675.1 hypothetical protein LR48_Vigan10g156700 [Vigna angularis] Length = 223 Score = 54.3 bits (129), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS*GNGNLG 109 ET NH Q+SEEMEFWYN+F+KSGQ S N NLG Sbjct: 186 ETEDNHDSCQLSEEMEFWYNIFIKSGQTSRDNENLG 221 >XP_013450568.1 myb transcription factor [Medicago truncatula] KEH24596.1 myb transcription factor [Medicago truncatula] Length = 207 Score = 52.8 bits (125), Expect = 1e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS 88 E M +HG SQISEE+EFWY+VF+KSGQPS Sbjct: 179 ENMDHHGSSQISEEIEFWYDVFIKSGQPS 207 >XP_007147213.1 hypothetical protein PHAVU_006G105200g [Phaseolus vulgaris] ESW19207.1 hypothetical protein PHAVU_006G105200g [Phaseolus vulgaris] Length = 215 Score = 52.4 bits (124), Expect = 2e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS 88 ET+ NHG Q+SEEMEFWYN+F+KSGQ S Sbjct: 187 ETVDNHGSCQLSEEMEFWYNIFIKSGQTS 215 >BAT87925.1 hypothetical protein VIGAN_05135000 [Vigna angularis var. angularis] Length = 223 Score = 52.4 bits (124), Expect = 2e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +2 Query: 2 ETMGNHGPSQISEEMEFWYNVFVKSGQPS*GNGNLG 109 ET +H Q+SEEMEFWYN+F+KSGQ S N NLG Sbjct: 186 ETEDSHDSCQLSEEMEFWYNIFIKSGQTSRDNENLG 221 >XP_015968249.1 PREDICTED: myb-related protein Myb4-like [Arachis duranensis] AHB59590.1 putative R2R3 MYB protein 2 [Arachis hypogaea] Length = 220 Score = 50.4 bits (119), Expect = 1e-05 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = +2 Query: 2 ETMGNH--GPSQISEEMEFWYNVFVKSGQPS 88 ETMGNH G Q+SEEMEFWYN+F+KSGQ S Sbjct: 190 ETMGNHNDGSIQLSEEMEFWYNIFIKSGQLS 220