BLASTX nr result
ID: Glycyrrhiza32_contig00027384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027384 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003588831.1 WRKY family transcription factor [Medicago trunca... 54 4e-06 >XP_003588831.1 WRKY family transcription factor [Medicago truncatula] AES59082.1 WRKY family transcription factor [Medicago truncatula] Length = 255 Score = 53.9 bits (128), Expect = 4e-06 Identities = 28/32 (87%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 355 IEEYVGSLIKDPDFTTALAEAVARTITDQ-HK 263 IEEY SLIKDPDFT ALAEAVARTITDQ HK Sbjct: 211 IEEYASSLIKDPDFTAALAEAVARTITDQEHK 242