BLASTX nr result
ID: Glycyrrhiza32_contig00027145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00027145 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017408299.1 PREDICTED: cyclic dof factor 3-like isoform X2 [V... 75 2e-13 XP_014510300.1 PREDICTED: cyclic dof factor 3-like [Vigna radiat... 75 2e-13 XP_017408291.1 PREDICTED: cyclic dof factor 3-like isoform X1 [V... 75 2e-13 KYP55548.1 Dof zinc finger protein DOF3.3, partial [Cajanus cajan] 72 2e-12 DAA64911.1 TPA_inf: dof protein [Cajanus cajan] 72 3e-12 XP_003524761.1 PREDICTED: cyclic dof factor 3-like [Glycine max]... 72 3e-12 KRH03488.1 hypothetical protein GLYMA_17G101000 [Glycine max] 71 4e-12 KHN18558.1 Dof zinc finger protein DOF3.3 [Glycine soja] KRH0348... 71 5e-12 NP_001304489.1 cyclic dof factor 3 [Glycine max] ACU18293.1 unkn... 71 5e-12 AFK42521.1 unknown [Medicago truncatula] 64 4e-10 XP_016192216.1 PREDICTED: cyclic dof factor 3 [Arachis ipaensis] 65 5e-10 XP_015942791.1 PREDICTED: cyclic dof factor 3-like [Arachis dura... 65 5e-10 XP_007155301.1 hypothetical protein PHAVU_003G1893001g, partial ... 65 1e-09 XP_003527086.1 PREDICTED: cyclic dof factor 3-like [Glycine max]... 65 1e-09 DAA64944.1 TPA_inf: dof protein [Cajanus cajan] KYP47170.1 Dof z... 64 2e-09 XP_013459285.1 DOF-type zinc finger DNA-binding family protein [... 64 2e-09 ACJ85660.1 unknown [Medicago truncatula] 64 2e-09 AFK34595.1 unknown [Medicago truncatula] 64 2e-09 KHN01870.1 Dof zinc finger protein DOF3.3 [Glycine soja] 64 3e-09 XP_006578570.1 PREDICTED: cyclic dof factor 3-like [Glycine max]... 64 3e-09 >XP_017408299.1 PREDICTED: cyclic dof factor 3-like isoform X2 [Vigna angularis] Length = 457 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKKEEKNHVEASPVLMANPAALSRS NFHENS Sbjct: 421 FKAFQSKKEEKNHVEASPVLMANPAALSRSLNFHENS 457 >XP_014510300.1 PREDICTED: cyclic dof factor 3-like [Vigna radiata var. radiata] Length = 469 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKKEEKNHVEASPVLMANPAALSRS NFHENS Sbjct: 433 FKAFQSKKEEKNHVEASPVLMANPAALSRSLNFHENS 469 >XP_017408291.1 PREDICTED: cyclic dof factor 3-like isoform X1 [Vigna angularis] KOM33285.1 hypothetical protein LR48_Vigan01g284100 [Vigna angularis] BAT76573.1 hypothetical protein VIGAN_01459500 [Vigna angularis var. angularis] Length = 470 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKKEEKNHVEASPVLMANPAALSRS NFHENS Sbjct: 434 FKAFQSKKEEKNHVEASPVLMANPAALSRSLNFHENS 470 >KYP55548.1 Dof zinc finger protein DOF3.3, partial [Cajanus cajan] Length = 392 Score = 72.0 bits (175), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQ KK+EKNHVEASPVLMANPAALSRS NFHENS Sbjct: 356 FKAFQPKKDEKNHVEASPVLMANPAALSRSLNFHENS 392 >DAA64911.1 TPA_inf: dof protein [Cajanus cajan] Length = 443 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQ KK+EKNHVEASPVLMANPAALSRS NFHENS Sbjct: 407 FKAFQPKKDEKNHVEASPVLMANPAALSRSLNFHENS 443 >XP_003524761.1 PREDICTED: cyclic dof factor 3-like [Glycine max] KHN48693.1 Dof zinc finger protein DOF3.3 [Glycine soja] KRH56903.1 hypothetical protein GLYMA_05G025900 [Glycine max] Length = 473 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKK EKNHVEASP+LMANPAALSRS NFHENS Sbjct: 437 FKAFQSKKNEKNHVEASPLLMANPAALSRSLNFHENS 473 >KRH03488.1 hypothetical protein GLYMA_17G101000 [Glycine max] Length = 344 Score = 71.2 bits (173), Expect = 4e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKK EKNHVEASP+LMANPAALSRS NFHENS Sbjct: 308 FKAFQSKKGEKNHVEASPMLMANPAALSRSLNFHENS 344 >KHN18558.1 Dof zinc finger protein DOF3.3 [Glycine soja] KRH03487.1 hypothetical protein GLYMA_17G101000 [Glycine max] Length = 471 Score = 71.2 bits (173), Expect = 5e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKK EKNHVEASP+LMANPAALSRS NFHENS Sbjct: 435 FKAFQSKKGEKNHVEASPMLMANPAALSRSLNFHENS 471 >NP_001304489.1 cyclic dof factor 3 [Glycine max] ACU18293.1 unknown [Glycine max] Length = 471 Score = 71.2 bits (173), Expect = 5e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQSKK EKNHVEASP+LMANPAALSRS NFHENS Sbjct: 435 FKAFQSKKGEKNHVEASPMLMANPAALSRSLNFHENS 471 >AFK42521.1 unknown [Medicago truncatula] Length = 190 Score = 63.9 bits (154), Expect = 4e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 6 KAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 KAFQSKK+ KNHV+ SP+LMANPAAL+RS NFHENS Sbjct: 155 KAFQSKKDGKNHVQTSPMLMANPAALARSLNFHENS 190 >XP_016192216.1 PREDICTED: cyclic dof factor 3 [Arachis ipaensis] Length = 493 Score = 65.5 bits (158), Expect = 5e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQS KEEKN VEASPVL ANPAALSRS NFHE+S Sbjct: 457 FKAFQSTKEEKNQVEASPVLRANPAALSRSLNFHESS 493 >XP_015942791.1 PREDICTED: cyclic dof factor 3-like [Arachis duranensis] Length = 494 Score = 65.5 bits (158), Expect = 5e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +3 Query: 3 FKAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 FKAFQS KEEKN VEASPVL ANPAALSRS NFHE+S Sbjct: 458 FKAFQSTKEEKNQVEASPVLRANPAALSRSLNFHESS 494 >XP_007155301.1 hypothetical protein PHAVU_003G1893001g, partial [Phaseolus vulgaris] ESW27295.1 hypothetical protein PHAVU_003G1893001g, partial [Phaseolus vulgaris] Length = 424 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 9 AFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 AFQSKK+EK+ VEASPVLMANPAALSRS NFHENS Sbjct: 390 AFQSKKDEKSRVEASPVLMANPAALSRSLNFHENS 424 >XP_003527086.1 PREDICTED: cyclic dof factor 3-like [Glycine max] KHN26253.1 Dof zinc finger protein DOF3.3 [Glycine soja] KRH54567.1 hypothetical protein GLYMA_06G194800 [Glycine max] Length = 458 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/38 (86%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FKAFQSKKEEKNHV-EASPVLMANPAALSRSFNFHENS 113 FK FQSKKEEK+HV EASPVL ANPAALSRS NFHENS Sbjct: 421 FKGFQSKKEEKDHVVEASPVLRANPAALSRSLNFHENS 458 >DAA64944.1 TPA_inf: dof protein [Cajanus cajan] KYP47170.1 Dof zinc finger protein DOF3.3 [Cajanus cajan] Length = 442 Score = 63.9 bits (154), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FKAFQSKKEEKNHV-EASPVLMANPAALSRSFNFHENS 113 FK FQSKK+EKNHV E SPVL ANPAALSRS NFHENS Sbjct: 405 FKGFQSKKDEKNHVVETSPVLRANPAALSRSLNFHENS 442 >XP_013459285.1 DOF-type zinc finger DNA-binding family protein [Medicago truncatula] KEH33316.1 DOF-type zinc finger DNA-binding family protein [Medicago truncatula] Length = 465 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 6 KAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 KAFQSKK+ KNHV+ SP+LMANPAAL+RS NFHENS Sbjct: 430 KAFQSKKDGKNHVQTSPMLMANPAALARSLNFHENS 465 >ACJ85660.1 unknown [Medicago truncatula] Length = 465 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 6 KAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 KAFQSKK+ KNHV+ SP+LMANPAAL+RS NFHENS Sbjct: 430 KAFQSKKDGKNHVQTSPMLMANPAALARSLNFHENS 465 >AFK34595.1 unknown [Medicago truncatula] Length = 465 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 6 KAFQSKKEEKNHVEASPVLMANPAALSRSFNFHENS 113 KAFQSKK+ KNHV+ SP+LMANPAAL+RS NFHENS Sbjct: 430 KAFQSKKDGKNHVQTSPMLMANPAALARSLNFHENS 465 >KHN01870.1 Dof zinc finger protein DOF3.3 [Glycine soja] Length = 470 Score = 63.5 bits (153), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FKAFQSKKEEKNHV-EASPVLMANPAALSRSFNFHENS 113 FK FQSKK+EK+HV EASPVL ANPAALSRS NFHENS Sbjct: 433 FKGFQSKKDEKDHVVEASPVLRANPAALSRSLNFHENS 470 >XP_006578570.1 PREDICTED: cyclic dof factor 3-like [Glycine max] KRH63324.1 hypothetical protein GLYMA_04G168300 [Glycine max] Length = 470 Score = 63.5 bits (153), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FKAFQSKKEEKNHV-EASPVLMANPAALSRSFNFHENS 113 FK FQSKK+EK+HV EASPVL ANPAALSRS NFHENS Sbjct: 433 FKGFQSKKDEKDHVVEASPVLRANPAALSRSLNFHENS 470