BLASTX nr result
ID: Glycyrrhiza32_contig00026832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00026832 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ALG05253.2 hypothetical protein 5E7_035 [uncultured bacterium 5E7] 56 4e-07 >ALG05253.2 hypothetical protein 5E7_035 [uncultured bacterium 5E7] Length = 245 Score = 55.8 bits (133), Expect = 4e-07 Identities = 34/64 (53%), Positives = 37/64 (57%), Gaps = 7/64 (10%) Frame = -1 Query: 296 FGKQSLEPVHCASH----SRGA---EDPLSRSYGVNLQSSLARVFSRDLRILFPPTCVGF 138 F KQS+ PVHCAS +RG+ E P SRSYG L SSL V L PPTCVG Sbjct: 101 FVKQSVGPVHCASRPLLPARGSYRQEGPFSRSYGAILPSSLTEVLPITLGRSPPPTCVGL 160 Query: 137 RYRH 126 RY H Sbjct: 161 RYGH 164