BLASTX nr result
ID: Glycyrrhiza32_contig00026370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00026370 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterran... 54 1e-06 GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterran... 54 1e-06 >GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterraneum] Length = 623 Score = 53.5 bits (127), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +3 Query: 108 EGLGLMIIVRGMRKSFC-EELKHSFSEGIGITAPK 209 EGLGLM I+RGM++SFC E+LK SF +GIGITAPK Sbjct: 54 EGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPK 88 >GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterraneum] Length = 625 Score = 53.5 bits (127), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +3 Query: 108 EGLGLMIIVRGMRKSFC-EELKHSFSEGIGITAPK 209 EGLGLM I+RGM++SFC E+LK SF +GIGITAPK Sbjct: 56 EGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPK 90