BLASTX nr result
ID: Glycyrrhiza32_contig00026241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00026241 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH56723.1 hypothetical protein GLYMA_05G015700 [Glycine max] 80 9e-18 KOM33130.1 hypothetical protein LR48_Vigan01g268600 [Vigna angul... 75 5e-16 XP_007155175.1 hypothetical protein PHAVU_003G179800g [Phaseolus... 75 2e-15 >KRH56723.1 hypothetical protein GLYMA_05G015700 [Glycine max] Length = 122 Score = 80.1 bits (196), Expect = 9e-18 Identities = 41/50 (82%), Positives = 42/50 (84%) Frame = -3 Query: 192 KVKSLEAAVHRSLPEFGCGRTQSMNRSINLCIQRSLCLLYVISSFLCLRL 43 +VKSLEAAVHRSLPEFGCGRTQS NRSINLCIQRSLCL SFL L L Sbjct: 58 EVKSLEAAVHRSLPEFGCGRTQSKNRSINLCIQRSLCLSLPAISFLFLLL 107 >KOM33130.1 hypothetical protein LR48_Vigan01g268600 [Vigna angularis] Length = 85 Score = 74.7 bits (182), Expect = 5e-16 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 78 RGKVSAGCRGLSTDSCFVFFHIQTQEEIDEPLPPVT 185 RGKVSAGCRGLSTDSCFVFFH Q QEEIDEPLPPVT Sbjct: 7 RGKVSAGCRGLSTDSCFVFFHSQIQEEIDEPLPPVT 42 >XP_007155175.1 hypothetical protein PHAVU_003G179800g [Phaseolus vulgaris] ESW27169.1 hypothetical protein PHAVU_003G179800g [Phaseolus vulgaris] Length = 172 Score = 75.5 bits (184), Expect = 2e-15 Identities = 42/64 (65%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -3 Query: 189 VKSLEAAVHRSLPEFGCGRTQSMNRSINLCIQRSLCL-LYVISSFLCLRLR*RIP*HHFF 13 VK+LEAAVHRSLPEFGCGRTQ+ NRSINLCIQRSLCL L IS + + L + HFF Sbjct: 93 VKTLEAAVHRSLPEFGCGRTQNKNRSINLCIQRSLCLSLPTISLLIYIALTNSLY-KHFF 151 Query: 12 EFFF 1 + F Sbjct: 152 QSVF 155