BLASTX nr result
ID: Glycyrrhiza32_contig00026133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00026133 (744 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), p... 75 1e-11 XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), p... 70 6e-10 XP_003607694.1 disease resistance protein (TIR-NBS-LRR class) [M... 68 2e-09 XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [M... 67 4e-09 XP_013453134.1 disease resistance protein (TIR-NBS-LRR class) [M... 62 2e-07 XP_013456698.1 disease resistance protein (TIR-NBS-LRR class) [M... 62 2e-07 XP_003607596.1 disease resistance protein (TIR-NBS-LRR class) [M... 62 2e-07 GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] 58 4e-06 XP_013453139.1 disease resistance protein (TIR-NBS-LRR class), p... 57 8e-06 XP_013453138.1 disease resistance protein (TIR-NBS-LRR class), p... 57 8e-06 XP_003620652.2 disease resistance protein (TIR-NBS-LRR class), p... 57 8e-06 >XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89817.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1055 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/56 (64%), Positives = 43/56 (76%), Gaps = 3/56 (5%) Frame = -3 Query: 694 DLKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ---LMHHGTSLARKRKFLAIEDEA 536 D+ M A I +GL +EV+NCGYHWV+K DLQ +MH G S+ARKRKFLAIEDEA Sbjct: 998 DINMKASIMKGQGLDLEVQNCGYHWVYKPDLQELTMMHPGNSVARKRKFLAIEDEA 1053 >XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89895.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1157 Score = 69.7 bits (169), Expect = 6e-10 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 5/69 (7%) Frame = -3 Query: 703 TPGDLKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIEDE 539 T GD++M LI D EGL VEVKNCGY WV+K DLQ +MH +SLA+ L IEDE Sbjct: 1020 TLGDIRMEVLIVDGEGLDVEVKNCGYRWVYKHDLQHLNFTMMHCKSSLAQNCDILGIEDE 1079 Query: 538 A*QQPQSLI 512 A QP+ L+ Sbjct: 1080 A--QPELLL 1086 >XP_003607694.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89891.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 962 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 4/50 (8%) Frame = -3 Query: 655 LHVEVKNCGYHWVFKQDLQ----LMHHGTSLARKRKFLAIEDEA*QQPQS 518 L +EVKNCGY W++KQDLQ M+HG SLA KRKFL IEDEA QQP++ Sbjct: 906 LGIEVKNCGYRWIYKQDLQELNYKMNHGNSLAGKRKFLEIEDEAQQQPKT 955 >XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89794.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1054 Score = 67.0 bits (162), Expect = 4e-09 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 5/55 (9%) Frame = -3 Query: 691 LKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIED 542 + M A +ED GLHV+VK CGY +VFKQDL+ +MHH A+KRKFLAIED Sbjct: 1000 ITMTACLEDGNGLHVDVKTCGYRYVFKQDLKQFNSTVMHHRNPFAQKRKFLAIED 1054 >XP_013453134.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] KEH27162.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1334 Score = 62.4 bits (150), Expect = 2e-07 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Frame = -3 Query: 706 KTPGDLKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIED 542 K G ++A + N+ +EVK+CGYHWV KQDLQ +M+H SLA K K LAIED Sbjct: 997 KFAGIKRVAGMFLGNKLSGMEVKSCGYHWVCKQDLQEFNLTMMNHEKSLASKCKILAIED 1056 Query: 541 EA*QQPQS 518 E QPQS Sbjct: 1057 ETQPQPQS 1064 >XP_013456698.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] KEH30729.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 840 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 5/55 (9%) Frame = -3 Query: 691 LKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIED 542 + M I++ EGLH EVK CGY +FKQD Q +MHH S ++KRKFLAIED Sbjct: 786 ITMTTFIDEREGLHGEVKKCGYRCIFKQDQQQFNSTMMHHRNSSSQKRKFLAIED 840 >XP_003607596.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89793.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1039 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 5/55 (9%) Frame = -3 Query: 691 LKMAALIEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIED 542 + M I++ EGLH EVK CGY +FKQD Q +MHH S ++KRKFLAIED Sbjct: 985 ITMTTFIDEREGLHGEVKKCGYRCIFKQDQQQFNSTMMHHRNSSSQKRKFLAIED 1039 >GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] Length = 347 Score = 57.8 bits (138), Expect = 4e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -3 Query: 655 LHVEVKNCGYHWVFKQDLQLMHH-GTSLARKRKFLAIEDEA*QQPQS 518 + V+V++CGY WV+KQDLQL H G L RK KFLAIEDEA QPQS Sbjct: 296 MDVKVQSCGYRWVYKQDLQLKHGCGNFLDRKCKFLAIEDEA--QPQS 340 >XP_013453139.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] KEH27167.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1152 Score = 57.4 bits (137), Expect = 8e-06 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 5/56 (8%) Frame = -3 Query: 673 IEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIEDEA*QQPQ 521 IE++EGL EVK+CGY WV KQDL+ +M+H S A+K K +AIE E QP+ Sbjct: 988 IEESEGLGFEVKSCGYRWVCKQDLRKLNFTMMNHENSFAQKCKIMAIEGETQPQPE 1043 >XP_013453138.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] KEH27166.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1186 Score = 57.4 bits (137), Expect = 8e-06 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 5/56 (8%) Frame = -3 Query: 673 IEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIEDEA*QQPQ 521 IE++EGL EVK+CGY WV KQDL+ +M+H S A+K K +AIE E QP+ Sbjct: 988 IEESEGLGFEVKSCGYRWVCKQDLRKLNFTMMNHENSFAQKCKIMAIEGETQPQPE 1043 >XP_003620652.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES76870.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1392 Score = 57.4 bits (137), Expect = 8e-06 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 5/56 (8%) Frame = -3 Query: 673 IEDNEGLHVEVKNCGYHWVFKQDLQ-----LMHHGTSLARKRKFLAIEDEA*QQPQ 521 IE++EGL EVK+CGY WV KQDL+ +M+H S A+K K +AIE E QP+ Sbjct: 988 IEESEGLGFEVKSCGYRWVCKQDLRKLNFTMMNHENSFAQKCKIMAIEGETQPQPE 1043