BLASTX nr result
ID: Glycyrrhiza32_contig00026036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00026036 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 3e-42 KRH13925.1 hypothetical protein GLYMA_15G273200 [Glycine max] 153 6e-41 KHN07701.1 Pentatricopeptide repeat-containing protein, chloropl... 153 6e-41 XP_003545972.2 PREDICTED: pentatricopeptide repeat-containing pr... 153 6e-41 XP_007025555.2 PREDICTED: pentatricopeptide repeat-containing pr... 151 2e-40 EOY28177.1 Tetratricopeptide repeat-like superfamily protein [Th... 151 2e-40 XP_007153023.1 hypothetical protein PHAVU_003G001300g [Phaseolus... 151 3e-40 XP_016206287.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 4e-40 XP_019453668.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 8e-40 GAU14842.1 hypothetical protein TSUD_50540 [Trifolium subterraneum] 147 9e-40 XP_015872792.1 PREDICTED: pentatricopeptide repeat-containing pr... 146 1e-39 XP_011651139.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 2e-39 KYP69015.1 Pentatricopeptide repeat-containing protein At2g22070... 148 2e-39 XP_004516023.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 3e-39 BAT98698.1 hypothetical protein VIGAN_10001800 [Vigna angularis ... 148 3e-39 XP_014490905.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 3e-39 XP_017426170.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 4e-39 XP_007214178.1 hypothetical protein PRUPE_ppa019185mg [Prunus pe... 147 5e-39 XP_019239908.1 PREDICTED: putative pentatricopeptide repeat-cont... 147 5e-39 XP_016442131.1 PREDICTED: putative pentatricopeptide repeat-cont... 147 5e-39 >XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494164.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494165.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494166.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] Length = 246 Score = 147 bits (372), Expect = 3e-42 Identities = 66/75 (88%), Positives = 72/75 (96%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LLS+HSEKLAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINR Sbjct: 172 EILLSYHSEKLAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINR 231 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 232 FHHFKDGSCSCGDYW 246 >KRH13925.1 hypothetical protein GLYMA_15G273200 [Glycine max] Length = 858 Score = 153 bits (386), Expect = 6e-41 Identities = 70/75 (93%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINR Sbjct: 784 EKLLYHHSEKLAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINR 843 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 844 FHHFKDGSCSCGDYW 858 >KHN07701.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 927 Score = 153 bits (386), Expect = 6e-41 Identities = 70/75 (93%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINR Sbjct: 853 EKLLYHHSEKLAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINR 912 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 913 FHHFKDGSCSCGDYW 927 >XP_003545972.2 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] XP_014623850.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Length = 930 Score = 153 bits (386), Expect = 6e-41 Identities = 70/75 (93%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINR Sbjct: 856 EKLLYHHSEKLAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINR 915 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 916 FHHFKDGSCSCGDYW 930 >XP_007025555.2 PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Theobroma cacao] Length = 946 Score = 151 bits (382), Expect = 2e-40 Identities = 69/75 (92%), Positives = 72/75 (96%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+SKIVSREIIVRDINR Sbjct: 872 EELLYHHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFISKIVSREIIVRDINR 931 Query: 182 FHHFKDGSCSCGDYW 226 +HHFKDGSCSCGDYW Sbjct: 932 YHHFKDGSCSCGDYW 946 >EOY28177.1 Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 946 Score = 151 bits (382), Expect = 2e-40 Identities = 69/75 (92%), Positives = 72/75 (96%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+SKIVSREIIVRDINR Sbjct: 872 EELLYHHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFISKIVSREIIVRDINR 931 Query: 182 FHHFKDGSCSCGDYW 226 +HHFKDGSCSCGDYW Sbjct: 932 YHHFKDGSCSCGDYW 946 >XP_007153023.1 hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] ESW25017.1 hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] Length = 858 Score = 151 bits (381), Expect = 3e-40 Identities = 69/75 (92%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRVKKNLR+CVDCH FFKFV KIVSREIIVRDINR Sbjct: 784 EKLLYHHSEKLAVAFGLIATPPGAPIRVKKNLRICVDCHIFFKFVCKIVSREIIVRDINR 843 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 844 FHHFKDGSCSCGDYW 858 >XP_016206287.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Arachis ipaensis] Length = 912 Score = 150 bits (380), Expect = 4e-40 Identities = 70/75 (93%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIAT PG+PIRVKKNLRVCVDCHTFFKFV KIVSREIIVRDINR Sbjct: 838 EKLLYHHSEKLAVAFGLIATSPGAPIRVKKNLRVCVDCHTFFKFVCKIVSREIIVRDINR 897 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 898 FHHFKDGSCSCGDYW 912 >XP_019453668.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Lupinus angustifolius] Length = 919 Score = 150 bits (378), Expect = 8e-40 Identities = 69/75 (92%), Positives = 70/75 (93%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAF LIATPPG+PIRVKKNLRVCVDCH FFKFV KIVSREIIVRDINR Sbjct: 845 EQLLYHHSEKLAVAFALIATPPGAPIRVKKNLRVCVDCHAFFKFVCKIVSREIIVRDINR 904 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 905 FHHFKDGSCSCGDYW 919 >GAU14842.1 hypothetical protein TSUD_50540 [Trifolium subterraneum] Length = 496 Score = 147 bits (370), Expect = 9e-40 Identities = 66/75 (88%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRV KNLRVCVDCHTF KFV+KIVSR+I+VRDINR Sbjct: 422 EKLLYHHSEKLAVAFGLIATPPGAPIRVMKNLRVCVDCHTFLKFVAKIVSRQIVVRDINR 481 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGD+W Sbjct: 482 FHHFKDGSCSCGDFW 496 >XP_015872792.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like, partial [Ziziphus jujuba] Length = 478 Score = 146 bits (369), Expect = 1e-39 Identities = 67/75 (89%), Positives = 69/75 (92%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRVKKNLRVC DCH FKF+ KIVSREIIVRDINR Sbjct: 404 EQLLLHHSEKLAVAFGLIATPPGAPIRVKKNLRVCPDCHAAFKFICKIVSREIIVRDINR 463 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 464 FHHFKDGSCSCGDYW 478 >XP_011651139.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cucumis sativus] KGN57354.1 hypothetical protein Csa_3G180420 [Cucumis sativus] Length = 924 Score = 149 bits (375), Expect = 2e-39 Identities = 66/75 (88%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG+PIRVKKNLRVC+DCHT FKF+SK+ SREIIVRDINR Sbjct: 850 EQLLWHHSEKLAVAFGLIATPPGAPIRVKKNLRVCIDCHTAFKFISKVASREIIVRDINR 909 Query: 182 FHHFKDGSCSCGDYW 226 FHHF+DGSCSCGDYW Sbjct: 910 FHHFRDGSCSCGDYW 924 >KYP69015.1 Pentatricopeptide repeat-containing protein At2g22070 family [Cajanus cajan] Length = 828 Score = 148 bits (374), Expect = 2e-39 Identities = 66/75 (88%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIATPPG PIRVKKNLR+CVDCHTFF+FV K+VSREIIVRDINR Sbjct: 754 EKLLYHHSEKLAVAFGLIATPPGVPIRVKKNLRICVDCHTFFRFVCKVVSREIIVRDINR 813 Query: 182 FHHFKDGSCSCGDYW 226 +HHFKDG+CSCGDYW Sbjct: 814 YHHFKDGTCSCGDYW 828 >XP_004516023.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cicer arietinum] Length = 925 Score = 148 bits (374), Expect = 3e-39 Identities = 68/75 (90%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGL+ATP G+PIRVKKNLRVCVDCHTF KFVSKIVSR+IIVRDINR Sbjct: 851 EKLLYHHSEKLAVAFGLVATPHGAPIRVKKNLRVCVDCHTFLKFVSKIVSRQIIVRDINR 910 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 911 FHHFKDGSCSCGDYW 925 >BAT98698.1 hypothetical protein VIGAN_10001800 [Vigna angularis var. angularis] Length = 835 Score = 148 bits (373), Expect = 3e-39 Identities = 67/75 (89%), Positives = 70/75 (93%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIA PPG+PIRVKKN+R+CVDCHTF KFV KIVSREIIVRDINR Sbjct: 761 EKLLYHHSEKLAVAFGLIAMPPGAPIRVKKNIRICVDCHTFLKFVCKIVSREIIVRDINR 820 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 821 FHHFKDGSCSCGDYW 835 >XP_014490905.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vigna radiata var. radiata] Length = 835 Score = 148 bits (373), Expect = 3e-39 Identities = 67/75 (89%), Positives = 70/75 (93%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIA PPG+PIRVKKN+R+CVDCHTF KFV KIVSREIIVRDINR Sbjct: 761 EKLLYHHSEKLAVAFGLIAMPPGAPIRVKKNIRICVDCHTFLKFVCKIVSREIIVRDINR 820 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 821 FHHFKDGSCSCGDYW 835 >XP_017426170.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vigna angularis] Length = 930 Score = 148 bits (373), Expect = 4e-39 Identities = 67/75 (89%), Positives = 70/75 (93%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LL HHSEKLAVAFGLIA PPG+PIRVKKN+R+CVDCHTF KFV KIVSREIIVRDINR Sbjct: 856 EKLLYHHSEKLAVAFGLIAMPPGAPIRVKKNIRICVDCHTFLKFVCKIVSREIIVRDINR 915 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 916 FHHFKDGSCSCGDYW 930 >XP_007214178.1 hypothetical protein PRUPE_ppa019185mg [Prunus persica] ONI10516.1 hypothetical protein PRUPE_4G051600 [Prunus persica] Length = 858 Score = 147 bits (372), Expect = 5e-39 Identities = 67/75 (89%), Positives = 71/75 (94%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 + LL +HSEKLAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+ KIVSREIIVRDINR Sbjct: 784 QRLLRYHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINR 843 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 844 FHHFKDGSCSCGDYW 858 >XP_019239908.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239909.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239910.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239911.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239913.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239914.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] Length = 883 Score = 147 bits (372), Expect = 5e-39 Identities = 66/75 (88%), Positives = 72/75 (96%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LLS+HSEKLAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINR Sbjct: 809 EILLSYHSEKLAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINR 868 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 869 FHHFKDGSCSCGDYW 883 >XP_016442131.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442133.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442134.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442135.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] Length = 883 Score = 147 bits (372), Expect = 5e-39 Identities = 66/75 (88%), Positives = 72/75 (96%) Frame = +2 Query: 2 EHLLSHHSEKLAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINR 181 E LLS+HSEKLAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINR Sbjct: 809 EILLSYHSEKLAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINR 868 Query: 182 FHHFKDGSCSCGDYW 226 FHHFKDGSCSCGDYW Sbjct: 869 FHHFKDGSCSCGDYW 883