BLASTX nr result
ID: Glycyrrhiza32_contig00025991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025991 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004491962.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 5e-08 >XP_004491962.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Cicer arietinum] Length = 700 Score = 57.8 bits (138), Expect = 5e-08 Identities = 32/53 (60%), Positives = 39/53 (73%), Gaps = 6/53 (11%) Frame = -3 Query: 141 MPIMLSSPFQFQNPVTC-LHKLGHYSFLTHTNARIITH---NNYL--DIVYLS 1 MPIML+ PFQF PVTC +KLG+Y+F+TH N I TH NNYL +IV+LS Sbjct: 1 MPIMLNFPFQFHYPVTCCFNKLGYYTFVTHANFCITTHNHNNNYLRNNIVFLS 53