BLASTX nr result
ID: Glycyrrhiza32_contig00025971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025971 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004492943.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 55 1e-06 >XP_004492943.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein [Cicer arietinum] Length = 377 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -1 Query: 269 NRKEGARKSPVDMEMEEGHQKRSSSHR*DNAHGRSSLERSGR 144 N+ EGA KSPV EMEEGH K SSSHR DN GRSS ERS R Sbjct: 231 NKTEGALKSPV--EMEEGHYKSSSSHRGDNPRGRSSSERSDR 270